Recombinant Human Chymotrypsin-like elastase family member 3B(CELA3B)

In Stock
Code CSB-EP007589HUb0
Product Type Recombinant Protein
Size
Uniprot No. P08861
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH
Research Area Cell Biology
Source E.coli
Gene Names CELA3B
Expression Region 29-270aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 30.0 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Efficient protease with alanine specificity but only little elastolytic activity.
Protein Families Peptidase S1 family, Elastase subfamily
Tissue Specificity Pancreas. Not detectable in keratinocytes.
Database Links

HGNC: 15945

KEGG: hsa:23436

STRING: 9606.ENSP00000338369

UniGene: Hs.728752

Related Products

CELA3B Proteins

CELA3B Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.