Recombinant Human Chymotrypsin-like elastase family member 3B (CELA3B)

Code CSB-BP007589HU
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CELA3B
Uniprot No.
Research Area
Cell Biology
Alternative Names
CELA3B; ELA3B; Chymotrypsin-like elastase family member 3B; EC 3.4.21.70; Elastase IIIB; Elastase-3B; Protease E
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
29-270aa
Target Protein Sequence
VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
28.8
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Efficient protease with alanine specificity but only little elastolytic activity.
Gene References into Functions
  1. The aim of this study was to examine the frequency of exocrine dysfunctions of the pancreas according to the level of fecal elastase-1 (FE-1) in patients with diabetes mellitus, type 1 and diabetes mellitus, type 2. PMID: 30106003
  2. this study demonstrated a strong association of diabetes with low pancreatic elastase levels in feces PMID: 27069032
  3. The results of the study suggest that the levels of apelin, TNF-alpha and elastase-1 are important diagnostic markers of CP in patients with type 2 diabetes mellitus. PMID: 26817104
  4. Recombinant type I pancreatic elastase improves unassisted arteriovenous fistula maturation in hemodialysis patients. PMID: 24684771
  5. A low value of faecal elastase-1, indicating reduced exocrine pancrease secretion, is strongly correlated with a poor survival in advanced pancreatic cancer. PMID: 22749648
  6. FE-1 is a poor surrogate for diagnosing impaired fat absorption. PMID: 22094930
  7. Hypermethylation of ELA3B gene promoter were associated with pancreatic cancer. PMID: 20428826
  8. As an independent variable, correlated with C-peptide and HBA1c levels in type 1 diabetes. PMID: 15277440
  9. pancreatic elastase induced proinflammatory effects are mediated by TLR4 and NF-kappaB in human myeloid cells PMID: 15351720
  10. Patients with type 1 diabetes and low fecal elastase 1 concentrations were succesfully treatted with pancretin. PMID: 17103488
  11. Fecal fat excretion is increased in patients with type 2 diabetes with fecal elastase deficiency. PMID: 17989309
  12. Neither low fecal elastase 1 nor raised fecal fat levels reliably indicate exocrine pancreatic insufficiency in type-1 diabetes. PMID: 18362841
  13. Reduced fecal elastase 1 connected with lowered serum levels of vitamin D3 is associated with osteoporotic bone fractures. PMID: 18424365
  14. Parathormone levels and Vitamin D metabolism in female patients with various grades of fecal ELA1 deficiency are reported. PMID: 19073396

Show More

Hide All

Protein Families
Peptidase S1 family, Elastase subfamily
Tissue Specificity
Pancreas. Not detectable in keratinocytes.
Database Links

HGNC: 15945

KEGG: hsa:23436

STRING: 9606.ENSP00000338369

UniGene: Hs.728752

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*