Recombinant Human Ciliary neurotrophic factor (CNTF)

In Stock
Code CSB-MP005683HU
Abbreviation Recombinant Human CNTF protein
MSDS
Size $132
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of CNTF was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Developmental Biology
Alternative Names
CNTF
Source
Mammalian cell
Expression Region
1-200aa
Target Protein Sequence
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.4 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
Gene References into Functions
  1. Our findings suggest that CNTF over-expression enhances the protective effects of bone marrow mesenchymal stem cells on retinal pigment epithelium cells, thus indicating subretinal-transplantation of CNTF-bone marrow mesenchymal stem cells may be a promising therapy for blue-light -injured retina PMID: 29564604
  2. Cytokines of the LIF/CNTF family and metabolism PMID: 26817395
  3. High hydrostatic pressure enables almost 100% refolding of recombinant human ciliary neurotrophic factor from inclusion bodies at high concentration. PMID: 28323167
  4. CNTFR-specific mutants of CNTF have been developed that bind to the CNTFRalpha-LIFRbeta-gp130 receptor. PMID: 26187860
  5. Human CNTF expression through lentiviral gene transfer in the rat striatum significantly decreased the levels of neuronal metabolites (N-acetyl-aspartate, N-acetyl-aspartyl-glutamate, and glutamate). PMID: 25833344
  6. the biological effects of CNTF on retinoic acid (RA)-predifferentiated SH-SY5Y neuroblastoma cells and the underlying molecular mechanism of this effect were investigated for the first time PMID: 25118897
  7. R28E mutation in CNTF abrogatesIL-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130/ LIFR. PMID: 24802752
  8. In this review, CNTF plays an important role in neurogenesis and differentiation of neural stem cells. PMID: 23948898
  9. The levels of expression and secretion of BDNF and CTNF of induced cells were assessed using immunocytochemical, Real-Time polymerase chain reaction, and enzyme linked immunosorbent assay (ELISA). PMID: 23944834
  10. CNTF elevated in umbilical cord blood from pre-eclamptic pregnancies PMID: 23654315
  11. CNTF-mediated protection of photoreceptors requires initial activation of the cytokine receptor gp130 in Muller glial cells. PMID: 24191003
  12. Report favourable allelic patterns of ACTN3 and CNTF genes on aerobic performance in athletes. PMID: 23676962
  13. Data indicate that aspirin increased mRNA and protein expression of CNTF in primary mouse and human astrocytes in a dose- and time-dependent manner. PMID: 23653362
  14. we show that the release of CNTF by glial cells is a very powerful stimulus for optic fiber regeneration and retinal ganglion cell survival after optic nerve crush PMID: 23194670
  15. Ciliary neurotrophic factor levels were increased in painful PTT only. PMID: 22337942
  16. Peptide 6c, corresponding to human CNTF amino acid residues 147-150, induces neurogenesis, neuronal activity and proliferation of immature neurons in the dentate gyrus and improvement of spatial reference memory in mice. PMID: 20952820
  17. CNTF's effects on retinal pigment epithelial (RPE) physiology PMID: 21912637
  18. Data show that variants in CNTF were significantly associated with a lower age at onset of the eating disorders. PMID: 20219210
  19. The role played by CNTF in retinal cell differentiation and survival in retinal progenitors, is reported. PMID: 20428961
  20. Ciliary neurotrophic factor, and related (CNTF), ligands targeting the established CNTF receptor alpha, binds to sortilin with high affinity. PMID: 20584990
  21. In women the CNTF polymorphism (odds ratio (OR) = 2.15, 95%CI: 1.27-3.64, p = 0.004) are associated with weight gain. PMID: 19833146
  22. Studies indicate that leptin, CNTF, LIF and IL-6 present similar three-dimensional fold structure, interact with related class-I receptors and activate similar intracellular pathways. PMID: 19751193
  23. A null mutation in this protein was evaluated for a relationship to disease susceptibility and disease severity in patients with multiple sclerosis. PMID: 11857064
  24. Association of a null mutation in the CNTF gene with early onset of multiple sclerosis. PMID: 11890844
  25. Early onset of severe familial amyotrophic lateral sclerosis with a SOD-1 mutation: potential impact of CNTF as a candidate modifier gene. PMID: 11951178
  26. CTNF binds to the IL-6 receptor and has a role in neuroprotection PMID: 12643274
  27. no evidence found to suggest that ciliary neurotrophic factor is involved in the pathogenesis of pelvic endometriosis PMID: 12890930
  28. Constitutive expression of cytokines in brain induces changes in gene expression characteristic of chronic inflammation leading to either temporal weight reduction (CNTF) or severe cachexia (leukemia inhibitory factor). PMID: 14715713
  29. Results do not support an effect of the CNTF null allele on body composition, contrary to previous findings. PMID: 14747836
  30. findings support the hypothesis that CNTF and leptin engage distinct CNS sites and CNTF possesses inflammatory properties distinct from leptin PMID: 15047605
  31. In spite of axokine gene expression in retinal pigment epithelium, no photoreceptor rescue in retinal degeneration mice. PMID: 15180291
  32. myogenic lineage-committed human myoblasts can dedifferentiate at a clonal level; CNTF is a novel regulator of skeletal myoblast dedifferentiation via p44/p42 MAPK pathway PMID: 15843428
  33. CNTF negatively regulates phototransduction, which reduces the photoresponsiveness of rods, resulting in lower electroretinogram amplitudes following light stimulus. PMID: 17192435
  34. Possible neuroprotective role of CNTF in the optic nerve head. PMID: 17563726
  35. We conclude that absence of CNTF does not increase susceptibility for neurodegenerative disorders and confirm that it does not affect onset and course of familial and sporadic ALS. PMID: 17651970
  36. Continuous expression of striatal CNTF at the dose mediated by the expression cassette used in this study was detrimental to transgenic mice with Huntington's disease. PMID: 18293418
  37. The relative treatment benefit of iloperidone compared with placebo in patients with schizophrenia is enhanced in patients homozygous G/G for the rs1800169 polymorphism of CNTF. PMID: 18303965
  38. In vivo and in vitro experiments implicate CNTF as an endogenous regulatory component of dopamine D2-receptor-dependent neurogenesis in the subventricular zone and the dentate gyrus of the hippocampus. (Review) PMID: 18524890
  39. CNTF-mediated signaling is a molecular switch for neuronal versus glial differentiation of retinal stem cells/progenitors. PMID: 18669911
  40. Ciliary neurotrophic factor, cardiotrophin-like cytokine, and neuropoietin share a conserved binding site on the ciliary neurotrophic factor receptor alpha chain PMID: 18728012
  41. PTP-1B constitutes a key divergent element between leptin/insulin and CNTF signaling pathways at the neuronal level. PMID: 19008309
  42. Certain SNP patterns in VDR and CNTF genes showed better improvement of parameters associated with the effects of low-resistance training using exercise machines as analyzed by comparison between SNP patterns and factor analysis. PMID: 19082510
  43. The results of this study provided further evidence that the production of ciliary neurotrophic factor by Schwann cells is markedly reduced in Charcot-Marie-Tooth type 1A neuropathy. PMID: 19525893
  44. Fusion of HIV-1 TAT to CNTF may have modified the CNTF capacity to induce intracellular signaling in hypothalamic neurons. PMID: 19573019
  45. The CNTF 1357 G --> A polymorphism explains only a small portion of the variability in the muscle strength response to training in women. PMID: 19628720
  46. An interaction between apoE3 and CNTF occurs with both delipidated apeE3 and apoE3 found within a lipoprotein particle in cerebrospinal fluid. This interaction potentiates the survival-promoting activity of CNTF for hippocampal neurons. PMID: 9236223

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
CNTF family
Tissue Specificity
Nervous system.
Database Links

HGNC: 2169

OMIM: 118945

KEGG: hsa:1270

STRING: 9606.ENSP00000355370

UniGene: Hs.524920

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*