Recombinant Human Clathrin heavy chain 2 (CLTCL1), partial

In Stock
Code CSB-EP005594HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CLTCL1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
CLTCL1; CLH22; CLTCL; CLTDClathrin heavy chain 2; Clathrin heavy chain on chromosome 22; CLH-22
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1423-1566aa
Target Protein Sequence
LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
20.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network.
Gene References into Functions
  1. Provide biochemical evidence for separate regulation and distinct functional niches for CHC17 and CHC22 in HeLa cells. Furthermore, the greater stability of the CHC22 coat relative to the CHC17 coat may be relevant to its excessive accumulation with GLUT4 during insulin resistance. PMID: 29097553
  2. Clathrin heavy chain 22 contributes to the control of neuropeptide degradation and secretion during neuronal development. Study suggests This suggests that a reduction in CHC22 expression in sensory neural precursors may license a step in neuron precursor neurodevelopment; and that this step is mediated through control of a novel neuropeptide processing pathway. PMID: 29402896
  3. CLTCL1 is significantly upregulated in the developing human brain PMID: 26068709
  4. Depletion of clathrin heavy chain (CHC)17, but not the CHC22 clathrin isoform, by ribonucleic acid interference (RNAi) induces centrosome amplification and multipolar spindles. PMID: 22891263
  5. CHC22 was required for retrograde trafficking of certain cargo molecules from endosomes to the trans-Golgi network. PMID: 20065094
  6. Clathrin isoform CHC22 binds to sorting nexin 5 through a coiled-coil domain. PMID: 15133132
  7. role for CHC22 in formation of insulin-responsive GLUT4 compartments in muscle & adipocytes; CHC22 associated with expanded GLUT4 compartments in muscle in type 2 diabetes PMID: 19478182

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Membrane, coated pit; Peripheral membrane protein; Cytoplasmic side.
Protein Families
Clathrin heavy chain family
Tissue Specificity
Maximal levels in skeletal muscle. High levels in heart and testis. Low expression detected in all other tissues.
Database Links

HGNC: 2093

OMIM: 601273

KEGG: hsa:8218

STRING: 9606.ENSP00000445677

UniGene: Hs.368266

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*