Recombinant Human Clathrin heavy chain 2(CLTCL1) ,partial

Code CSB-EP005594HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P53675
Relevance Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma mbrane or to the trans-Golgi network .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Clathrin heavy chain on chromosome 22 ;CLH-22
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF
Research Area Signal Transduction
Source E.coli
Gene Names CLTCL1
Expression Region 1423-1566aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 20.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network (By similarity).
Subcellular Location Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Membrane, coated pit, Peripheral membrane protein, Cytoplasmic side
Protein Families Clathrin heavy chain family
Tissue Specificity Maximal levels in skeletal muscle. High levels in heart and testis. Low expression detected in all other tissues.
Database Links

HGNC: 2093

OMIM: 601273

KEGG: hsa:8218

STRING: 9606.ENSP00000445677

UniGene: Hs.368266

Pathway Endocytosis
Synaptic vesicle cycle

Related Products

CLTCL1 Antibodies

CLTCL1 Antibodies for Homo sapiens (Human)

CLTCL1 Antibodies for Human

CLTCL1 Proteins

CLTCL1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.