Recombinant Human Collagenase 3 (MMP13), partial

In Stock
Code CSB-EP014660HU3
Abbreviation Recombinant Human MMP13 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Developmental Biology
Alternative Names
Matrix metalloproteinase-13
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
195-471aa
Target Protein Sequence
YGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CCN2. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CCN2. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion.
Gene References into Functions
  1. MMP-13 plays a critical role in the shedding/cleavage of PD-L1 in the human head and neck squamous cell carcinoma. PMID: 29345283
  2. Data suggest that matrix metalloproteinase 13 (MMP-13) and its regulatory networks are suitable targets for the development of effective early treatment strategies for osteoarthritis (OA). PMID: 29126436
  3. High Expressions of MMP-13 is associated with degenerative knee osteoarthritis. PMID: 28418842
  4. Transfection of cells with either miR-100 or miR-125b negated the induction of MMP13 release. Additionally, AR activation induced a morphological alteration of MDA-MB-453 cells, which was blocked by miR-125b only. PMID: 28816390
  5. ATM could be activated by lung cancer-associated TNF-alpha, up-regulate MMP-13 expression and thereby augment tumor metastasis PMID: 27556690
  6. The Sp1-mediaded allelic regulation of MMP13 expression by an esophageal squamous cell carcinoma susceptibility SNP rs2252070 has been demonstrated. PMID: 27245877
  7. MMP-13 IRS represents a suitable method to assess pathologic grade of precancerous and cancerous colorectal lesions. MMP-13 has been identified as an excellent marker of high grade IEN and CRC, and may thus be applied for prognostic stratification. PMID: 27716617
  8. These findings suggest that using MMP-13 inhibitors in diffuse group might contribute to the control of tumor growth PMID: 28128735
  9. A strong association between the -77 MMP-13 polymorphism and posterior tibial tendinopathy insufficiency. PMID: 27886420
  10. TGF-beta1 stimulates the phosphorylation of Runx2 at three serine amino acids, and this event is required for MMP-13 expression in osteoblastic cells. PMID: 28419442
  11. IL-6-stimulated MMP-13 expression was independent of IL-1beta stimulation and was blocked by SAHA, suggesting that SAHA inhibits IL-6 signaling in Osteoarthritis (OA) chondrocytes. PMID: 27555113
  12. High MMP13 expression is associated with intervertebral disc degeneration. PMID: 28559201
  13. data demonstrate that MMP-13 is critical for the development of osteolytic lesions in Multiple myeloma and that targeting the MMP-13 protein - rather than its catalytic activity - constitutes a potential approach to mitigating bone disease in affected patients. PMID: 27043283
  14. Endoplasmic reticulum stress participates in the progress of senescence and apoptosis of osteoarthritic chondrocytes, which manifested in increased expression of ADAMTS5, MMP13, and decreased COL2A1 expression. PMID: 28728848
  15. these findings support roles for both cFOS (indirect) and ATF3 (direct) in effecting MMP13 transcription in human chondrocytes. PMID: 27956552
  16. In osteoarthritis (OA) chondrocytes, hydrostatic pressure (HP) restores the expression levels of some miRNAs, downregulates MMP-13, ADAMTS-5, and HDAC-4, and modulates the Wnt/beta-catenin pathway activation. PMID: 28085114
  17. These results suggested that HIF-2alpha may cause meniscal matrix degradation by transactivation of MMP-13 PMID: 26892680
  18. TGF-beta1 stimulated a sustained and prolonged expression of ATF-3, and its interaction and regulation of c-Jun protein and their assembly as a protein complex at the AP-1 site of the MMP-13 promoter could be responsible for MMP-13 gene activation in MDA-MB231 cells. PMID: 27751807
  19. Serum MMP13 did not differ significantly between normal weight, overweight, and obese participants. PMID: 27296149
  20. No significant association was observed in MMP13, TIMP2 and TGFB3 genes with CP or PI. CP is a risk factor to develop PI, however, there is no association of both diseases with polymorphisms in the MMP13, TIMP2 and TGFB3 genes PMID: 27058373
  21. Findings suggest thatSirt1 may regulate the expression of Runx2, which is the osteogenic transcription factor, and the production of MMP-13 from chondrocytes in OA. PMID: 27367673
  22. the mechanisms and roles of MMP-13 secretion in human small airway epithelial cells and functional polymorphisms of the MMP13 gene PMID: 26635116
  23. as the grade of late-stage osteoarthritis advanced, levels of TNF-alpha in the serum became elevated, whereas levels of MMP-13 in the synovial fluid became elevated PMID: 27130394
  24. As the grade of late stage osteoarthritis advances, increase in synovial MMP-13 and serum TNF-a levels become pronounced. PMID: 27932045
  25. High MMP13 serum levels are associated with Esophageal Squamous Cell Carcinoma. PMID: 27356690
  26. Our study demonstrates that miR-148a inhibits the migration of breast cancer cells by targeting MMP-13 PMID: 26298724
  27. MMP13 expression positively related to the lymph node and distal metastasis, tumor stage and relapse of colorectal cancer PMID: 25726157
  28. in degenerative intervertebral discs, IL1b upregulates NFkB, MMP13 and ADAMTS4 PMID: 25433723
  29. Expression of MMP13 negatively correlated with miR-27b expression in degenerative nucleus pulposus tissues. PMID: 26583473
  30. sustained released resveratrol inhibits interleukin-1beta-induced metalloproteinase-13 activation and promotes chondrocyte differentiation PMID: 26526931
  31. Report modified platelet deposition on matrix metalloproteinase 13 digested collagen I PMID: 26447617
  32. GP73 enhances MMP-13 expression through cAMP responsive element binding protein (CREB)-mediated transcription activation. Levels of GP73 and MMP-13 are increased and positively correlated in human HCC tissues. Augmented MMP-13 potentiates HCC cell metastasis. PMID: 26378022
  33. SENP2 inhibits MMP13 expression in BC cells through de-SUMOylation of TBL1/TBLR1, which inhibits nuclear translocation of beta-catenin. PMID: 26369384
  34. Hyaluronic acid exhibits a pronounced suppressive effect on MMP-13 expression in osteoarthritis. PMID: 26934732
  35. Elevated levels of MMP-13 may play a role in the pathogenesis of chronic periodontitis. There is a direct correlation of increased expression of MMP-13 with various clinical and histologic parameters in disease severity PMID: 25006778
  36. IL-1Ra is associated with MMP-13 expression and has a novel function in such regulation without interference of the IL-1 signaling cascade. PMID: 26474296
  37. siRNA inhibited the effect of MMP13-containing exosomes on tumor cells metastasis as well as angiogenesis PMID: 26362844
  38. RKIP Inhibits Local Breast Cancer Invasion by Antagonizing the Transcriptional Activation of MMP13 PMID: 26308852
  39. together, these data demonstrate that SERPINE2 might prevent cartilage catabolism by inhibiting the expression of MMP-13, one of the most relevant collagenases, involved in cartilage breakdown in OA. PMID: 26305372
  40. High expression of matrix metalloproteinase-13 is associated with pancreatic cancer. PMID: 25948792
  41. Together, these data suggest that shikonin may suppress Osteosarcoma invasiveness through MMP13 suppression. Thus, our data highlight a previous unappreciated role for shikonin in suppressing Osteosarcoma cell metastasis PMID: 26104765
  42. our results revealed that activation of the P2X7 receptor by ATP promotes breast cancer cell invasion and migration, possibly via activation of the AKT pathway and regulation of E-cadherin and MMP-13 expression. PMID: 25976617
  43. MMP-13 was associated with metastasis and poor survival in 79 patients with melanoma. MMP-13 expression was inversely correlated with vasculogenic mimicry. MMP-13 cleaves laminin-5 gamma 2 to accelerate metastasis. PMID: 25749207
  44. Together, these data suggest that GRh2 may suppress GBM migration through inhibiting Akt-mediated MMP13 activation. PMID: 25835975
  45. Both VEGF-C and MMP13 are significantly upregulated in Multiple Myeloma with lymph-node metastases. PMID: 25966777
  46. IL-32 stimulation promotes the invasion and motility of osteosarcoma cells, possibly via the activation of AKT and the upregulation of MMP-13 expression. PMID: 25846944
  47. Up-regulation of matrix metalloproteinase 13 is associated with colitis-associated cancer. PMID: 25742789
  48. Data show that knockdown of endogenous periostin attenuates constitutive matrix metalloproteinase-13 (MMP-13) expression. PMID: 26092928
  49. Clusterin is an independent predictive factor for prognosis of hepatocellular carcinoma and it facilitates metastasis through EIF3I/Akt/MMP13 signaling. PMID: 25609201
  50. High level of protein expression of MMP13 was significantly associated with poor prognosis in oral squamous cell carcinoma. PMID: 25401159

Show More

Hide All

Involvement in disease
Spondyloepimetaphyseal dysplasia Missouri type (SEMD-MO); Metaphyseal anadysplasia 1 (MANDP1); Metaphyseal dysplasia, Spahr type (MDST)
Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted.
Protein Families
Peptidase M10A family
Tissue Specificity
Detected in fetal cartilage and calvaria, in chondrocytes of hypertrophic cartilage in vertebrae and in the dorsal end of ribs undergoing ossification, as well as in osteoblasts and periosteal cells below the inner periosteal region of ossified ribs. Dete
Database Links

HGNC: 7159

OMIM: 250400

KEGG: hsa:4322

STRING: 9606.ENSP00000260302

UniGene: Hs.2936

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*