Recombinant Human Cyclic AMP-dependent transcription factor ATF-3(ATF3)

In Stock
Code CSB-EP002271HU
Product Type Recombinant Protein
Size US$2062
Uniprot No. P18847
Lead Time 3-7 business days
Relevance This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Research Area Cancer
Source E.coli
Gene Names ATF3
Protein Names Activating transcription factor 3
Expression Region 1-181aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 26.1 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This protein binds the cAMP response element (CRE) (consensus
Subcellular Location Nucleus
Protein Families BZIP family, ATF subfamily
Database Links

HGNC: 785

OMIM: 603148

KEGG: hsa:467

STRING: 9606.ENSP00000344352

UniGene: Hs.460

Related Products

ATF3 Antibodies

ATF3 Antibodies for Homo sapiens (Human)

ATF3 Antibodies for Human

ATF3 Proteins

ATF3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.