Recombinant Human Cyclic AMP-dependent transcription factor ATF-3 (ATF3)

In Stock
Code CSB-EP002271HU
Abbreviation Recombinant Human ATF3 protein
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Activating transcription factor 3; ATF3; ATF3_HUMAN; ATF3deltaZip2; ATF3deltaZip2c; ATF3deltaZip3; cAMP dependent transcription factor ATF3; cAMP-dependent transcription factor ATF-3; Cyclic AMP dependent transcription factor ATF3; Cyclic AMP-dependent transcription factor ATF-3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-181aa
Target Protein Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.1 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Enhance your cancer research capabilities with our premium Recombinant Human ATF3 protein. ATF3, or cyclic AMP-dependent transcription factor ATF-3, is a key player in cellular stress responses, regulating various biological processes such as apoptosis, cell survival, and inflammation. Its role in these processes makes it an essential target in cancer research.

Our Recombinant Human ATF3 protein represents the full-length protein, including the 1-181aa expression region, and is meticulously produced in E.coli. The N-terminal 6xHis-tag allows for ease of purification and detection, ensuring an exceptional product for your experiments. With a purity greater than 85% as determined by SDS-PAGE, our Recombinant Human ATF3 provides a reliable foundation for your cancer research needs. Available in both liquid and lyophilized powder forms, this protein caters to diverse experimental requirements.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGTActivates transcription presumably by sequestering inhibitory cofactors away from the promoters.
Gene References into Functions
  1. Therefore, though ATF3 is activated downstream of the Wnt/beta-catenin pathway, it acts as a negative regulator of the migration and invasion of HCT116 human colon cancer cells exhibiting aberrant Wnt/beta-catenin activity. ATF3 is a candidate biomarker and target for human colorectal cancer treatment and prevention. PMID: 29966001
  2. Luciferase reporter assay identified a direct interaction of 3' UTRs of ATF3 and Runx2 with miR-590-3p in these cells. Overexpression of miR-590-3p also decreased proliferation and increased apoptosis of breast cancer cells. PMID: 30076901
  3. ATF3 mediates the inhibitory action of TNF-alpha on osteoblast differentiation and that the TNF-alpha-activated JNK pathway is responsible for the induction of Atf3 expression. PMID: 29605296
  4. these data indicated that ATF3 might promote intestinal epithelial cell apoptosis in Crohn's disease via up-regulating the stability and transcription activity of p53 PMID: 29716766
  5. electrophilic properties of itaconate and derivatives regulate the IkappaBzeta-ATF3 inflammatory axis; results demonstrate that targeting the DI-IkappaBzeta regulatory axis could be an important new strategy for the treatment of IL-17-IkappaBzeta-mediated autoimmune diseases PMID: 29670287
  6. High ATF3 expression is associated with breast cancer. PMID: 29534690
  7. ATF3 and EGR1 are involved in the beginning of inflammatory processes. Whether these two transcription factors act as tumour suppressors or promoters is context dependent and warrants analysis in further studies PMID: 28803237
  8. ATF3 and PRAP1 play important roles in cisplatin-induced DNA damage repair process. PMID: 29886035
  9. Data show that amino acid limitation (amino acid response, AAR) activation of activating transcription factor 3 (ATF3) transcription is transient relative to activation by the unfolded protein response (UPR). PMID: 29413899
  10. In patients with NAFLD and/or T2D, a significant positive correlation was observed between hepatic ATF3 expression and surrogate markers of T2D, mitochondrial dysfunction, and macrophage infiltration. PMID: 28365312
  11. our results suggest that ATF3 promotes the invasion and proliferation of CRC cells, at least in part, via the regulation of CEACAM1-mediated EMT. PMID: 28402947
  12. ATF3 is involved in promoting particulate matter-induced pulmonary inflammation. PMID: 29378244
  13. Negative pressure wound therapy exerts an anti-inflammatory effect, possibly through the suppression of proinflammatory enzymes and cytokines resulting from Ik B-alpha inhibition and ATF-3 activation, which may prevent the activation of the NF-kappaB pathway in human diabetic foot wounds. PMID: 27883358
  14. ATF3 plays a significant role in regulating human endometrial receptivity and embryo attachment in vitro via up-regulation of leukemia inhibitory factor. PMID: 28577574
  15. Upregulation of ATF3 in lung cancer promotes cell proliferation, migration, and invasion, and may represent a novel therapeutic target for lung cancer PMID: 28239957
  16. ATF3 is a negative regulator of inflammation in human fetal membranes; in primary amnion cells, ATF3 expression is induced by IL-1beta and fsl-1, and ATF3 silencing further exacerbates the inflammatory response when stimulated with these factors. Subsequently, ATF3 expression is decreased in fetal membranes after term labour and with preterm chorioamnionitis, conditions closely associated with inflammation and infection. PMID: 27780541
  17. Altering TR4-ATF3 signaling increases the efficacy of cisplatin to suppress hepatocellular carcinoma growth/progression. PMID: 27050071
  18. ATF3 may be a potential early diagnostic biomarker for silicosis and ATF3 acts as a repressor in inflammatory responses induced by silica PMID: 29102675
  19. The analysis showed higher urinary NGAL and urinary ATF3 in patients with sepsis-AKI in comparison with patients with sepsis-non-AKI and healthy volunteers. PMID: 28061889
  20. ATF3 mRNA and protein expression was significantly reduced in preterm Preeclamptic placentas. Therefore, reduced ATF3 may be centrally involved in the pathology of Preeclampsia. PMID: 28947613
  21. Data suggest that suppression of nonsense-mediated RNA decay due to persistent DNA damage (from exposure to either mutagens, gamma rays, or oxidative stress) requires the activity of p38alpha MAPK (MAPK14, mitogen-activated protein kinase 14, MAP kinase p38 alpha); mRNA of ATF3 (activating transcription factor 3) is stabilized by persistent DNA damage in a p38alpha MAPK-dependent manner. PMID: 28765281
  22. The microvascular injury phenotypes observed in vitro and in vivo were similar. ATF3 plays an important role in mediating brain microvascular responses to acute and chronic lipotoxic injury and may be an important preventative and therapeutic target for endothelial dysfunction in vascular cognitive impairment . PMID: 27087439
  23. we have identified ATF3 as an important regulator of cisplatin cytotoxicity and that ATF3 inducers in combination with platins are a potential novel therapeutic approach for NSCLC. PMID: 27659012
  24. reactivation of ATF3 is an important factor in determining sensitivity to pracinostat treatment, both in vitro and in vivo, and could serve as a potential biomarker of response and provide a rationale for therapeutic utility in HDACi-mediated treatments for bladder cancer. PMID: 27196751
  25. these findings support roles for both cFOS (indirect) and ATF3 (direct) in effecting MMP13 transcription in human chondrocytes. PMID: 27956552
  26. We functionally validated several elements for metformin-induced promoter and enhancer activity. These include an enhancer in an ataxia telangiectasia mutated (ATM) intron that has SNPs in linkage disequilibrium .Using ChIP-seq and siRNA knockdown, we further show that activating transcription factor 3 (ATF3), our top metformin upregulated AMPK-dependent gene, could have an important role in gluconeogenesis repression. PMID: 27902686
  27. ATF3 inhibition significantly increased the expression of proinflammatory cytokines interleukin 6 and interleukin 8 in cigarette smoke extract stimulated human bronchial epithelial cells. PMID: 28185985
  28. ATF3 overexpression increased PFF-A-mediated cleaved PARP. PMID: 27043582
  29. Ang II-induced upregulation of ATF3 and SUMO1 in vitro and in vivo was blocked by Ang II type I receptor antagonist olmesartan. Moreover, Ang II induced ATF3 SUMOylation at lysine 42, which is SUMO1 dependent. PMID: 26850942
  30. As a result, ATF3 rather protected the p53 wild-type cells from UV-induced apoptosis. Our results thus indicate that ATF3 regulates cell fates upon UV irradiation in a p53-dependent manner. PMID: 26994140
  31. CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas. PMID: 26747248
  32. Activating transcription factor 3 represses inflammatory responses by binding to the p65 subunit of NF-kappaB PMID: 26412238
  33. TGRL lipolysis products induce stress protein ATF3 via the TGF-beta receptor pathway, resulting in induction of apoptosis in aortic endothelial cells PMID: 26709509
  34. ATF3 regulates canonical TGFbeta and Smad signaling and fibroblast activation in systemic sclerosis. PMID: 25589515
  35. ATF3 overexpression leads to an increase of collective cell invasion phenotype in Colorectal Cancer. PMID: 26851004
  36. Data suggest that after the expression of activating transcription factor 3 (ATF3) and microRNA miR-30c-2-3p elicited by lysophosphatidic acid, miR-30c-2-3p negatively regulates the expression of ATF3 through post-transcriptional silencing. PMID: 26418018
  37. Taken together, these results suggest that ATF3 promotes the progression of human gliomas PMID: 25872784
  38. DNA damage-triggered ATF3 controlled p53 accumulation and generation of double-strand breaks may serve as a switch between DNA damage and cell death following TOP2A inhibitor treatment. PMID: 25521189
  39. The stress-responsive gene ATF3 regulates the histone acetyltransferase Tip60 stability by promoting USP7-mediated deubiquitination of Tip60. PMID: 25865756
  40. ATF3 is inactive in healthy hepatic cells and activated following hepatitis C virus infection. PMID: 25816118
  41. The function of ATF3 is to block the reactivation of virus induced by neuronal stress. PMID: 26305977
  42. It compared the induction of ATF3 protein as measured by Western blot analysis with single-molecule localization microscopy dSTORM to quantify the dynamics of accumulation of intranuclear ATF3 of triglyceride-rich (TGRL) lipolysis product-treated HAEC. PMID: 25189785
  43. SUMO modification of ATF3 influences CCND1/2 activity and cellular proliferation of prostate cancer PC3 and DU145 cells and explains at least in part how ATF3 functions to regulate cancer development. PMID: 23591848
  44. Tissue array analysis suggests role for ATF3 in regulating the occurrence of glioma and disease progression. PMID: 26051724
  45. Human CHAC1 Protein Degrades Glutathione, and mRNA Induction Is Regulated by the Transcription Factors ATF4 and ATF3 and a Bipartite ATF/CRE Regulatory Element. PMID: 25931127
  46. these results suggest that there is a negative feedback expression of pre-mir-590 and its putative target gene, ATF-3 in human breast cancer cells. PMID: 25150595
  47. ATF3 is a downstream target of SRC and CaMKII signaling, and may be involved in adrenocortical aldosterone synthesis. PMID: 25400120
  48. Urotensin-II induces activating transcription factor 3 (ATF3) at both mRNA and protein levels. PMID: 25268131
  49. Suggest critical role for tumor suppressor ATF3 in esophageal squamous cell carcinoma progression. PMID: 25149542
  50. ATF-3 was associated with Runx2 promoter in MDA-MB231 cells. PMID: 25380580

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
BZIP family, ATF subfamily
Database Links

HGNC: 785

OMIM: 603148

KEGG: hsa:467

STRING: 9606.ENSP00000344352

UniGene: Hs.460

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*