Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial

Code CSB-YP882147HU
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP882147HU
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP882147HU-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP882147HU
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP882147HU
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
CDK12
Uniprot No.
Alternative Names
arginine/serine-rich; Cdc2 related kinase arginine/serine rich; CDC2 related protein kinase 7; Cdc2-related kinase; CDC2-related protein kinase 7; Cdk12; CDK12_HUMAN; Cell division cycle 2 related protein kinase 7; Cell division cycle 2-related protein kinase 7; Cell division protein kinase 12; CRK7; CRKR; CrkRS; Cyclin-dependent kinase 12; EC 2.7.11.22; hCDK12; kiaa0904; Pksc
Species
Homo sapiens (Human)
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I am interested in several of your recombinant proteins. Can you please provide some informations:
G)For CSB-EP882147HU (all expression systems):
a.Sequence
b.Tag type
c.Tag position
d.Sizes and formats
e.Is the protein provided soluble in solution?
f.Is the protein purified from bacterial inclusion bodies are you supplied refolded or still in urea?
g.I want to use this protein for conjugation purposes and need it supplied in an amine free buffer (so not Tris). Can you supply this protein in one of the buffers at my request: phosphate, carbonate, or borate? Would there be an extra charge?

A:
Thanks for your inquiry. Proteins will be supplied soluble in solution.
It is not certain for the protein to be expressed in the supernatant or precipitation, but our proteins are provided with folding correctly.
If you need it supplied in an amine free buffer (so not Tris). We can do this. Please mention this requirement in your official order. We can try to provide PBS buffer, this is not charged.
Recombinant Human Cyclin-dependent kinase 12(CDK12),partial
CSB-YP882147HU >> Yeast
CSB-EP882147HU >> E.coli
CSB-BP882147HU >> Baculovirus
CSB-MP882147HU >> Mammalian cell
Expression Region:727-1020aa;Partial,Protein kinase domain.
Tag information:EP,YP,BP,MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP:N-terminal 6xHis-tagged;EP,BP,MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

FDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFL


Target Background

Function
Cyclin-dependent kinase that phosphorylates the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A), thereby acting as a key regulator of transcription elongation. Regulates the expression of genes involved in DNA repair and is required for the maintenance of genomic stability. Preferentially phosphorylates 'Ser-5' in CTD repeats that are already phosphorylated at 'Ser-7', but can also phosphorylate 'Ser-2'. Required for RNA splicing, possibly by phosphorylating SRSF1/SF2. Involved in regulation of MAP kinase activity, possibly leading to affect the response to estrogen inhibitors.
Gene References into Functions
  1. Cyclin K expression positively correlates with cell proliferation; knockdown of cyclin K or its cognate kinase CDK12 prevents the assembly of prereplicative complex in the G1 cell cycle phase. PMID: 29760377
  2. CDK12 regulates prereplicative complex assembly to promote mammalian cell proliferation. PMID: 29760377
  3. CDK12 gene amplification can contribute to the pathogenesis of breast cancer. PMID: 28334900
  4. BRCA1 downregulation combined with CHK1 inhibition induced excessive amounts of DNA damage, resulting in an inability to complete the S-phase. Therefore, we suggest CHK1 inhibition as a strategy for targeting BRCA1- or CDK12-deficient tumors. PMID: 29025359
  5. In Ovarian Cancer patients CDK12 loss is consistently associated with a particular genomic instability pattern characterized by hundreds of tandem duplications PMID: 26787835
  6. Structures of CDK12/CycK complexes solved in the presence of AMP-PNP. PMID: 26597175
  7. Data show that most mutations prevent formation of the cyclin-dependent kinase 12 (Cdk12)/cyclin K (CycK) complex, rendering the kinase inactive. PMID: 25712099
  8. CDK12 affects RNA processing events in two distinct ways: Indirectly through generating factor-binding phospho-epitopes on the CTD of elongating RNAPII and directly through binding to specific factors PMID: 25429106
  9. CDK12 and CDK13 losses in HCT116 cells preferentially affect expression of DNA damage response. PMID: 25561469
  10. CDK12 plays an important role in cotranscriptional processing of c-FOS transcripts PMID: 25384976
  11. CDK12 has properties that should confirm interest in its use as a biomarker. PMID: 24240700
  12. many CDK12 mutations are an unrecognized cause of HR defects in ovarian cancers PMID: 24554720
  13. CDK12 interacts with cyclin K and is required to maintain embryonnic stem cell self-renewal. PMID: 22547058
  14. Cyclin K1 is the primary cyclin partner for CDK12/CrkRS and it is required for activation of CDK12/CrkRS to phosphorylate the C-terminal domain of RNA Pol II. PMID: 22988298
  15. through regulation of expression of DNA damage response genes, CycK/Cdk12 protects cells from genomic instability PMID: 22012619
  16. Data show that siRNA knockdown of hCDK12 in HeLa cells results in alterations in the CTD phosphorylation state. PMID: 20952539
  17. CRK7 modifies MAP kinases regulation and resistance to estrogen signaling inhibitors in breast cancers. PMID: 19651820

Show More

Hide All

Involvement in disease
Chromosomal aberrations involving CDK12 may be a cause gastric cancer. Deletions within 17q12 region producing fusion transcripts with ERBB2, leading to CDK12-ERBB2 fusion leading to trunctated CDK12 protein not in-frame with ERBB2.
Subcellular Location
Nucleus. Nucleus speckle. Note=Colocalized with nuclear speckles throughout interphase.
Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Tissue Specificity
Ubiquitously expressed.
Database Links

HGNC: 24224

OMIM: 615514

KEGG: hsa:51755

STRING: 9606.ENSP00000398880

UniGene: Hs.345028

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1