Name: Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial
Brand: CUSABIO
SKU: 882147HU

Product Details

Purity

>85% (SDS-PAGE)

Target Names

CDK12

Uniprot No.

Q9NYV4

Alternative Names

arginine/serine-rich; Cdc2 related kinase arginine/serine rich; CDC2 related protein kinase 7; Cdc2-related kinase; CDC2-related protein kinase 7; Cdk12; CDK12_HUMAN; Cell division cycle 2 related protein kinase 7; Cell division cycle 2-related protein kinase 7; Cell division protein kinase 12; CRK7; CRKR; CrkRS; Cyclin-dependent kinase 12; EC 2.7.11.22; hCDK12; kiaa0904; Pksc

Species

Homo sapiens (Human)

Protein Length

Partial

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Related Products

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I am interested in several of your recombinant proteins. Can you please provide some informations:
G)For CSB-EP882147HU (all expression systems):
a.Sequence
b.Tag type
c.Tag position
d.Sizes and formats
e.Is the protein provided soluble in solution?
f.Is the protein purified from bacterial inclusion bodies are you supplied refolded or still in urea?
g.I want to use this protein for conjugation purposes and need it supplied in an amine free buffer (so not Tris). Can you supply this protein in one of the buffers at my request: phosphate, carbonate, or borate? Would there be an extra charge?

Thanks for your inquiry. Proteins will be supplied soluble in solution.
It is not certain for the protein to be expressed in the supernatant or precipitation, but our proteins are provided with folding correctly.
If you need it supplied in an amine free buffer (so not Tris). We can do this. Please mention this requirement in your official order. We can try to provide PBS buffer, this is not charged.
Recombinant Human Cyclin-dependent kinase 12(CDK12),partial
CSB-YP882147HU >> Yeast
CSB-EP882147HU >> E.coli
CSB-BP882147HU >> Baculovirus
CSB-MP882147HU >> Mammalian cell
Expression Region:727-1020aa;Partial,Protein kinase domain.
Tag information:EP,YP,BP,MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP:N-terminal 6xHis-tagged;EP,BP,MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

FDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFL

Target Background

Function

Cyclin-dependent kinase that phosphorylates the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A), thereby acting as a key regulator of transcription elongation. Regulates the expression of genes involved in DNA repair and is required for the maintenance of genomic stability. Preferentially phosphorylates 'Ser-5' in CTD repeats that are already phosphorylated at 'Ser-7', but can also phosphorylate 'Ser-2'. Required for RNA splicing, possibly by phosphorylating SRSF1/SF2. Involved in regulation of MAP kinase activity, possibly leading to affect the response to estrogen inhibitors.

Gene References into Functions

Cyclin K expression positively correlates with cell proliferation; knockdown of cyclin K or its cognate kinase CDK12 prevents the assembly of prereplicative complex in the G1 cell cycle phase. PMID: 29760377
CDK12 regulates prereplicative complex assembly to promote mammalian cell proliferation. PMID: 29760377
CDK12 gene amplification can contribute to the pathogenesis of breast cancer. PMID: 28334900
BRCA1 downregulation combined with CHK1 inhibition induced excessive amounts of DNA damage, resulting in an inability to complete the S-phase. Therefore, we suggest CHK1 inhibition as a strategy for targeting BRCA1- or CDK12-deficient tumors. PMID: 29025359
In Ovarian Cancer patients CDK12 loss is consistently associated with a particular genomic instability pattern characterized by hundreds of tandem duplications PMID: 26787835
Structures of CDK12/CycK complexes solved in the presence of AMP-PNP. PMID: 26597175
Data show that most mutations prevent formation of the cyclin-dependent kinase 12 (Cdk12)/cyclin K (CycK) complex, rendering the kinase inactive. PMID: 25712099
CDK12 affects RNA processing events in two distinct ways: Indirectly through generating factor-binding phospho-epitopes on the CTD of elongating RNAPII and directly through binding to specific factors PMID: 25429106
CDK12 and CDK13 losses in HCT116 cells preferentially affect expression of DNA damage response. PMID: 25561469
CDK12 plays an important role in cotranscriptional processing of c-FOS transcripts PMID: 25384976
CDK12 has properties that should confirm interest in its use as a biomarker. PMID: 24240700
many CDK12 mutations are an unrecognized cause of HR defects in ovarian cancers PMID: 24554720
CDK12 interacts with cyclin K and is required to maintain embryonnic stem cell self-renewal. PMID: 22547058
Cyclin K1 is the primary cyclin partner for CDK12/CrkRS and it is required for activation of CDK12/CrkRS to phosphorylate the C-terminal domain of RNA Pol II. PMID: 22988298
through regulation of expression of DNA damage response genes, CycK/Cdk12 protects cells from genomic instability PMID: 22012619
Data show that siRNA knockdown of hCDK12 in HeLa cells results in alterations in the CTD phosphorylation state. PMID: 20952539
CRK7 modifies MAP kinases regulation and resistance to estrogen signaling inhibitors in breast cancers. PMID: 19651820

Hide All

Involvement in disease

Chromosomal aberrations involving CDK12 may be a cause gastric cancer. Deletions within 17q12 region producing fusion transcripts with ERBB2, leading to CDK12-ERBB2 fusion leading to trunctated CDK12 protein not in-frame with ERBB2.

Subcellular Location

Nucleus. Nucleus speckle. Note=Colocalized with nuclear speckles throughout interphase.

Protein Families

Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily

Tissue Specificity

Ubiquitously expressed.

Database Links

HGNC: 24224

OMIM: 615514

KEGG: hsa:51755

STRING: 9606.ENSP00000398880

UniGene: Hs.345028

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-YP882147HU
MSDS	MSDS
Size	Pls inquire
Source	Yeast
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP882147HU
MSDS	MSDS
Size	Pls inquire
Source	E.coli
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP882147HU-B
MSDS	MSDS
Size	Pls inquire
Source	E.coli
Conjugate	Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-BP882147HU
MSDS	MSDS
Size	Pls inquire
Source	Baculovirus
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-MP882147HU
MSDS	MSDS
Size	Pls inquire
Source	Mammalian cell
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage