Recombinant Human Cystatin-B(CSTB)

Code CSB-EP006100HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P04080
Relevance This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CPI-B Liver thiol proteinase inhibitor Stefin-B
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Research Area Cell Biology
Source E.coli
Gene Names CSTB
Protein Names Recommended name: Cystatin-B Alternative name(s): CPI-B Liver thiol proteinase inhibitor Stefin-B
Expression Region 1-98aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 27.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.
Involvement in disease Epilepsy, progressive myoclonic 1 (EPM1)
Subcellular Location Cytoplasm, Nucleus
Protein Families Cystatin family
Database Links

HGNC: 2482

OMIM: 254800

KEGG: hsa:1476

STRING: 9606.ENSP00000291568

UniGene: Hs.695

Related Products

CSTB Antibodies

CSTB Antibodies for Homo sapiens (Human)

CSTB Antibodies for Human

CSTB Proteins

CSTB Proteins for Homo sapiens (Human)

CSTB ELISA Kit

CSTB ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.