Recombinant Human Cytokine-like protein 1 (CYTL1)

In Stock
Code CSB-MP873640HU
Size $590
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CYTL1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Protein C17
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-136aa
Target Protein Sequence
TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
40.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFC-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The pipeline for the recombinant Human CYTL1 protein production in mammalian cells consists of the following consecutive steps: construction of the expression vector encoding the Human CYTL1 protein (23-136aa), its transformation into mammalian cells, high-density cultivation and induction of the positive cells, cell lysis, and expression analysis. The protein features a C-terminal hFc tag fusion. The resulting recombinant Human CYTL1 protein is purified from the cell lysate through affinity purification, and its purity is greater than 85% determined by the SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Circular dichroism analysis showed that, like chemokines, CYTL1has a higher content of beta-sheet than alpha-helix secondary structure; recombinant CYTL1 promoted calcium flux in chondrocytes; unlike chemokines, CYTL1 had limited affinity to proteoglycans; together, these properties further support cytokine-like properties for CYTL1 with some overlap with the chemokines PMID: 28478073
  2. this study shows that CYTL1 possesses chemotactic activity and demonstrates that its functional receptor is CCR2B PMID: 27084102
  3. when the native signal peptide of CYTL1 was replaced by IgGkappaSP, the expression and secretion was increased by 4 fold. PMID: 26922322
  4. role in regulation embryo implantation PMID: 26800213
  5. Cytl1 is highly expressed in the endometrium during the embryo implantation and its expression is regulated by ovarian hormones. Cytl1 enhances endometrial proliferation, induces the secretion of endometrial LIF and HB-EGF, and even enhances endometrial cell adhesion to trophoblastic cells. These indicate that Cytl1 is a potential molecular mediator of embryo is a potential molecular mediator in embryo implantation. PMID: 26800213
  6. our results showed the first evidence of CYTL1 expression in SH-SY5Y neuroblastoma cells and human NB tissues, revealed a possible link between CYTL1 and NB development PMID: 22797702
  7. evidence suggests that ANKRD7 and CYTL1 genes may play an important role in the variance in alcohol drinking risk PMID: 22613542
  8. C17orf62-L could induce cell death accompanied with rising of cleaved PARP. PMID: 21503106
  9. The DNA methylation pattern of the CYTL1 promoter region was significantly different between early and advanced stages of squamous cell carcinoma. PMID: 22011669
  10. C17 as a cytokine that s contributes to immune homeostasis systemically or in a tissue-specific manner in the joint PMID: 21799806
  11. We report a structural-functional characterization of cytokine-like protein 1 (Cytl1) by a combination of different computational structure-based techniques. PMID: 21322034

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Specifically expressed in CD34+ hematopoietic cells.
Database Links

HGNC: 24435

OMIM: 607930

KEGG: hsa:54360

STRING: 9606.ENSP00000303550

UniGene: Hs.13872

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*