Recombinant Human DNA-dependent protein kinase catalytic subunit (PRKDC), partial, Biotinylated

In Stock
Code CSB-EP018714HU1-B
Abbreviation Recombinant Human PRKDC protein, partial, Biotinylated
MSDS
Size $308
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
DNPK1;Ser-473 kinase;p460
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
3478-3559aa
Target Protein Sequence
ETLSLMTKEISSVPCWQFISWISHMVALLDKDQAVAVQHSVEEITDNYPQAIVYPFIISSESYSFKDTSTGHKNKEFVARIK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
57.1 kDa
Protein Length
Partial
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). Recruited by XRCC5 and XRCC6 to DNA ends and is required to (1) protect and align broken ends of DNA, thereby preventing their degradation, (2) and sequester the DSB for repair by NHEJ. Act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. As part of the DNA-PK complex, involved in the early steps of ribosome assembly by promoting the processing of precursor rRNA into mature 18S rRNA in the small-subunit processome. Binding to U3 small nucleolar RNA, recruits PRKDC and XRCC5/Ku86 to the small-subunit processome. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX, thereby regulating DNA damage response mechanism. Phosphorylates DCLRE1C, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, FH, SRF, NHEJ1/XLF, XRCC1, XRCC4, XRCC5, XRCC6, WRN, MYC and RFA2. Can phosphorylate C1D not only in the presence of linear DNA but also in the presence of supercoiled DNA. Ability to phosphorylate p53/TP53 in the presence of supercoiled DNA is dependent on C1D. Contributes to the determination of the circadian period length by antagonizing phosphorylation of CRY1 'Ser-588' and increasing CRY1 protein stability, most likely through an indirect mechanism. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.
Gene References into Functions
  1. Small cell lung cancer (SCLC) subtype had amplified risk with XRCC7 6721G>T. Gene-environment interaction analysis revealed that XRCC6 61C>G showed a strong protective effect towards lung cancer. Survival analysis revealed poor prognosis in case of XRCC6 61C>G SCLC subtype. XRCC7 6721G>T subjects with SCLC subtype showed an increased susceptibility while poor prognosis in case of XRCC6 61C>G. PMID: 29397516
  2. Loss of DNA-PKc expression is associated with impairment of non-homologous end-joining of radiation-induced double strand break repair in nasopharyngeal carcinoma. PMID: 29344644
  3. DNA-dependent protein kinase plays a central role in transformation of breast epithelial cells following alkylation damage. PMID: 28923836
  4. miRNA-101 level is decreased in RCC tissues/cells, which could be responsible for DNA-PKcs overexpression and DNA-PKcs mediated oncogenic actions; DNA-PKcs over-expression regulates mTORC2-AKT activation, HIF-2alpha expression and RCC cell proliferation PMID: 27412013
  5. The study reveals a structural basis for the complex assembly of DNA-PK and an allosteric mechanism for the activation of DNA-PKcs. PMID: 28840859
  6. DNA-PK holoenzyme cryo-EM map reveals density for the C-terminal globular domain of Ku80 that interacts with the arm of DNA-PKcs PMID: 28652322
  7. Data indicate that abnormal ERGIC1 and DNA-PKcs expression may play an important role in gastric cancer initiation. PMID: 28970727
  8. The crystal structure defines a stage on which many of the components assemble and regulate the kinase activity through modulating the conformation and allosteric regulation of kinase activity. PMID: 28668119
  9. downregulation of PRKDC sensitized MCF-7 cells to chemo-drugs both in vitro and in a xenografted mouse model. Collectively, our study demonstrated that PRKDC is a prognostic biomarker for chemoresistance in breast cancer patients. PMID: 28498431
  10. Down-regulation of PRKDC attenuates tumor progression in prostate cancer (PCa). PRKDC may potentially be a prognostic biomarker in PCa. PMID: 27856181
  11. Suggest that IL-10 rs1800871 and PRKDC rs7003908 may be useful biomarkers for predicting glioma patient survival. PMID: 27811370
  12. Results provide evidence that DNA-PKcs is a primary resistance factor of salinomycin in osteosarcoma cells. PMID: 27765904
  13. This study showed that the levels of CD44 and DNA-PK are associated with a better survival and better response to radiotherapy and temozolomide. PMID: 28070830
  14. this study suggests that improved anti-proliferative and cytotoxic effects of Ag-np treatment in cancer cells can be achieved by the inhibition of DNA-PKcs. PMID: 29150048
  15. this study has solved the PRKDC structure in complex with the C-terminal peptide of Ku80 at 4.3 angstrom resolution using x-ray crystallography. PMID: 28154079
  16. DNA-PKcs, which is integral to the non-homologous end joining pathway, negatively regulates ATM activity through phosphorylation of ATM. PMID: 27939942
  17. that EZH2 is phosphorylated by the DNA damage responsive complex DNA-PK and regulates DNA damage-mediated T-cell apoptosis. PMID: 27468692
  18. DNA-PKcs is a potent regulator of IL-2 production in T lymphocytes. PMID: 28750002
  19. TMU-35435 enhances etoposide cytotoxicity by regulating ubiquitin-proteasomal degradation of DNA-PKcs and inhibiting the DNA repair pathway in triple negative breast cancer cells. PMID: 28450160
  20. DNA-PK directly phosphorylates hSSB1 at serine residue 134. While this modification is largely suppressed in undamaged cells by PPP-family protein phosphatases, S134 phosphorylation is enhanced following the disruption of replication forks and promotes cellular survival. PMID: 28448822
  21. DNA-PK activity in peripheral blood lymphocytes might be a useful marker for predicting prostate-specific antigen relapse and urinary toxicity, possibly contributing to personalized treatment of prostate cancer. PMID: 28399576
  22. Data suggest that the model can replicate amplified p53 responses under DNA-PK inhibition and provide insights into cell fate decision by manipulating p53 dynamics. PMID: 28177883
  23. Dual TORK/DNA-PK inhibition blocks critical signaling pathways in chronic lymphocytic leukemia. PMID: 27235137
  24. These studies clarify the role of PKCdelta in endothelial cell cytoskeleton regulation. PMID: 27442243
  25. T204 was identified as a main target for ATM/DNA-PKcs phosphorylation on human POLL, and this phosphorylation may facilitate the repair of a subset of IR-induced DSBs and the efficient POLL-mediated gap-filling during NHEJ. POLL phosphorylation might favor POLL interaction with the DNA-PK complex at DSBs. PMID: 28109743
  26. DNA-PKcs inhibitor acriflavine exerts a p53-dependent synergistic efficacy with melphalan against human cancer cells both in vitro and in vivo. PMID: 27693638
  27. EBV-LMP1 suppresses the DNA damage response through DNA-PK/AMPK signaling to promote radioresistance in nasopharyngeal carcinoma. PMID: 27255972
  28. Together, our results provide evidence that acetylation potentially regulates DNA-PKcs. PMID: 27297111
  29. Inhibiting PRKDC radiosensitizes human osteosarcoma cells. PMID: 28300555
  30. these results suggest that miR-101 sensitizes pancreatic cancer cells to gemcitabine possibly via downregulating DNA-PKcs. PMID: 27988337
  31. The bocavirus large viral nonstructural protein NS1 is sufficient to induce the DNA damage response and the activation of the host ATM, ATR, and DNAPK. PMID: 27733644
  32. inhibition of DNAPKcs decreases Pgp expression and sensitizes osteosarcoma cancer stem cells to chemotherapeutic agents in vitro PMID: 27499034
  33. These results suggested potential usefulness of the phosphorylation status of XRCC4 Ser320 as an indicator of DNA-PK functionality in living cells. PMID: 26666690
  34. Data show that elevated expression of DNA-dependent protein kinase catalytic subunit (DNA-PKcs), Akt3 protein, and tumor suppressor protein p53 (p53) in ovarian serous adenocarcinoma tissues are an indication of more advanced disease and worse prognosis. PMID: 27629740
  35. CDK2 and DNA-PK regulate PR transcriptional activity by distinct mechanisms. PMID: 26652902
  36. Results show that under hypoxia, Ku70 and DNA-PKcs interact with nuclear RON which activates non-homologous end joining DNA repair conferring chemoresistance. PMID: 26772202
  37. A significantly different distribution was found in the frequency of PRKDC (rs7003908) genotype between the ESCC group and controls. Individuals homozygous for the C allele had a significant (3.185-fold) increased risk of ESCC. PMID: 26166223
  38. Transient knockdown of PRKDC reduced cell proliferation/survival in HCT116 and DLD1, but not FHC cells. PRKDC down-regulation induced apoptosis partially through inhibiting AKT activation, and sensitized HCT116 cells to chemotherapeutic agents PMID: 26992638
  39. DNA methylation modification plays an important role to regulate the gene expression of XRCC5 and XRCC7, from the results that the gene methylation level of the glioma group is higher than that of the normal group PMID: 26464705
  40. The ends are then closely aligned, which requires XLF, a non-catalytic function of XRCC4-LIG4, and DNA-PK activity PMID: 26990988
  41. suggested that DNA-PK and PARP-dependent recruitment of XRCC1 is necessary to effectively protect, repair, and restart stalled replication forks, providing new insight into how genomic stability is preserved PMID: 26603896
  42. Data show that inhibition of DNA-dependent protein kinase catalytic subunit (DNA-PK) prevents type I DNA topoisomerase (Top1) degradation and proteasome activity in camptothecin (CPT)-treated quiescent WI38 cells. PMID: 26578593
  43. protein deficiency impairs Ig class switch recombination PMID: 26546606
  44. These results provide new evidence linking cell cycle to bystander responses and demonstrate that DNA-PKcs and ATM are two associated factors in co-regulating G2-M phase-related bystander effects. PMID: 26774662
  45. c-Myc protein functions in the process of DNA double-strand break repair, at least partially, through affecting the ATM phosphorylation and DNA-PKcs kinase activity. PMID: 26049366
  46. DNA-PKcs has a role in cancer metastasis through regulation of secreted proteins involved in migration and invasion PMID: 26017556
  47. Results show that activated DNA-PKcs is elevated in medullary thyroid tumor samples and its expression correlates with expression of RET in thyroid tumors. PMID: 26065416
  48. Our study supported that DNA-PKcs was involved in drug-induced DNA damage repair and related to chemosensitivity of osteosarcoma MG63 cells PMID: 26108997
  49. Kaposi's sarcoma-associated herpesvirus appears then to selectively activate DNA damage response pathways via the ATM and DNA-PK DNA damage response kinases. PMID: 26057167
  50. BRCA1-BER deficient cells could be targeted by ATM or DNA-PKcs inhibitors for personalized therapy. PMID: 25205036

Show More

Hide All

Involvement in disease
Immunodeficiency 26 with or without neurologic abnormalities (IMD26)
Subcellular Location
Nucleus. Nucleus, nucleolus.
Protein Families
PI3/PI4-kinase family
Database Links

HGNC: 9413

OMIM: 600899

KEGG: hsa:5591

STRING: 9606.ENSP00000313420

UniGene: Hs.491682

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*