Recombinant Human DNA repair endonuclease XPF (ERCC4), partial

In Stock
Code CSB-EP849795HU
Abbreviation Recombinant Human ERCC4 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
DNA excision repair protein ERCC-4;DNA repair protein complementing XP-F cells;Xeroderma pigmentosum group F-complementing protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
658-916aa
Target Protein Sequence
RGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTPEMCVERKSISDLIGSLNNGRLYSQCISMSRYYKRPVLLIEFDPSKPFSLTSRGALFQEISSNDISSKLTLLTLHFPRLRILWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.6 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalytic component of a structure-specific DNA repair endonuclease responsible for the 5-prime incision during DNA repair. Involved in homologous recombination that assists in removing interstrand cross-link.
Gene References into Functions
  1. For 11985 A>G polymorphism, lung cancer subjects treated with irinotecan cisplatin/carboplatin regimen having heterozygous genotype (AG) was associated with high mortality risk (p = 0.0001). 673 C>T polymorphism was associated with increased lung cancer risk. PMID: 29741112
  2. Our results confirm that biallelic ERCC4 mutations cause a cerebellar ataxia-dominant phenotype with mild cutaneous symptoms, possibly accounting for a high proportion of the genetic causes of ARCA in Japan, where XP-F is prevalent. PMID: 29403087
  3. silenced XPF significantly increased the sensitivity and survival following treatment with cisplatin in xenograft mice bearing renal cell tumor. PMID: 27542841
  4. C allele of the 30028T/C polymorphism significantly increased the risk of ischemic stroke. PMID: 26888738
  5. Polymorphisms in XPF gene is associated with gastrointestinal stromal tumours. PMID: 27460091
  6. inherited abnormalities in DNA repair pathway related to XPF 30028C and TP53 Arg72Pro polymorphisms act as prognostic factors for progression free survival and overall survival of cutaneous melanoma patients. PMID: 26427666
  7. Based on these results, we conclude that the XPF gene polymorphism Ser835Ser may be associated with a decreased risk of colorectal cancer. PMID: 26146099
  8. Polymorphisms of ERCC4 gene are associated with HPV-positive cervical cancer. PMID: 25812040
  9. Helicobacter Pylori introduces double-stranded DNA breaks by the nucleotide excision repair endonucleases XPF and XPG, which, together with RelA, are recruited to chromatin in a highly coordinated, type IV secretion system-dependent manner. PMID: 26411687
  10. SLX4 (FANCP) and XPF (FANCQ) proteins interact with each other and play a vital role in the Fanconi anemia (FA) DNA repair pathway. PMID: 26453996
  11. Mus81-deficient cells fail to recover from exposure to low doses of replication inhibitors and cell viability is dependent on the XPF endonuclease. PMID: 25879486
  12. Genotypes of ERCC1 (rs11615, rs3212986 and rs2298881) and XPF (rs2276465 and rs6498486) were performed by Polymerase Chain Reaction Restriction Fragment Length Polymorphism (PCR-RFLP) assay PMID: 26045829
  13. XPF and XPC expression may be a potential predictive factor for bladder cancer, and smoking can not only influence the recurrence of bladder cancer as a single factor but also aggravate the results of the XPF defect and XPC defect. PMID: 25535740
  14. Low XPF expression in head and neck squamous cell carcinoma patients is associated with better response to induction chemoradiotherapy, while high XPF expression correlates with a worse response. PMID: 25019640
  15. ERCC4 is located on human chromosome 16p13.12 and consists of 11 exons spanning about 28.2 kb, the broad tissue expression pattern of ERCC4 is similar to that of ERCC1; ERCC1 and ERCC4 genes encode the two subunits of the ERCC1-XPF nuclease. This enzyme plays an important role in repair of DNA damage and in maintaining genomic stability. [Review] PMID: 26074087
  16. This meta-analysis suggests that the 3 common XPF polymorphisms rs744154, rs6498486, and rs1799801 are not associated with gastric cancer risk. PMID: 25342505
  17. ERCC4 rs1800067 polymorphism is not associated with cancer risk. PMID: 25292041
  18. Our study suggests that the rs1800067 genetic variant of XPF functions in the development of glioma. PMID: 24938470
  19. genetic variants in XPF might contribute to the susceptibility to ESCC PMID: 24709955
  20. The contribution of ERCC4/FANCQ coding mutations to hereditary breast cancer in Central and Eastern Europe is likely to be small. PMID: 24465539
  21. no significant associations between XPF polymorphisms in rs2276466 or rs6498486 and risk of colorectal cancer in a Chinese population PMID: 24861646
  22. The C2169A nonsense mutation in XPF protein is closely associated with gastric carcinogenesis in the Chinese population.The XPF mutation is largely monoallelic indicating the haplo-insufficiency of XPF. PMID: 24412486
  23. the frequency of Spanish individuals heterozygous for pathogenic mutations in the ERCC4 gene is approximately 0.3%, and it does not differ between familial breast/ovarian cancer patients and healthy controls. PMID: 24027083
  24. The rs1800067 G and rs2276466 G allele frequencies in Xeroderma pigmentosum complementation group f polymorphisms influence risk of glioma. PMID: 23991957
  25. Overexpression of XPF decreased drug sensitivity in malignant melanoma. PMID: 23982883
  26. ERCC4 rs1800124 and MBD4 rs10342 non-synonymous single nucleotide polymorphism variants were associated with DNA repair capacity. PMID: 24004570
  27. Polymorphisms in rs180067, rs1799801, rs2276466 and rs744154 in XPF is associated with gastric cancer. PMID: 23679285
  28. a significantly decreased risk of gastric cancer associated with the ERCC4 rs744154 GC/CC genotypes in a Chinese population PMID: 23537993
  29. Frameshift mutation XP11BE not only divests the XPF-interaction motif impairing DNA repair, but also reduces XPB solubility, leading to a lower intracellular level of transcription factor TFIIH and deficient transcription. PMID: 23385459
  30. Mutations in ERCC4, encoding the DNA-repair endonuclease XPF, cause Fanconi anemia. PMID: 23623386
  31. The ERCC4 tagSNPs, rs6498486 and rs254942, may play protective roles in gastric carcinogenesis, especially in the development of atrophic gastritis. PMID: 23415627
  32. two SNPs (rs2276466 and rs3136038) in ERCC4 may be functional and contribute to SCCHN susceptibility PMID: 22848636
  33. XPG endonuclease promotes DNA breaks and DNA demethylation at promoters allowing the recruitment of CTCF and gene looping, which is further stabilized by XPF. PMID: 22771116
  34. This meta-analysis suggests a lack of statistical evidence for the association between the four XPF SNPs and overall risk of cancers. PMID: 22768293
  35. There is no evidence that G1244A and T2505 single nucleotide polymorphisms in XPF affect expression of ERCC1. PMID: 22609620
  36. XPF Arg415Gln may be a low-penetrant risk factor in the Caucasian ethnicity for developing breast cancer. PMID: 21424776
  37. these results suggest that the interaction between XPF and Eg5 plays a role in mitosis and DNA repair and offer new insights into the pathogenesis of XP-F and XFE. PMID: 22353549
  38. Data show that high XPF expression correlated with early time to progression both by univariate and multivariate analysis. PMID: 21737503
  39. The gene polymorphism at ERCC4 gene had no effects on the DNA damage of lymphocytes in coke oven workers. PMID: 17945097
  40. results indicated that Arg399Gln polymorphism of XRCC1 gene and Arg415Gln polymorphism of ERCC4 gene may not be associated with smoking- and drinking-related larynx cancer in Polish population PMID: 21423097
  41. The association of MPM with DNA repair genes support the hypothesis that an increased susceptibility to DNA damage may favour asbestos carcinogenicity. PMID: 21277872
  42. squamous cell carcinoma metastases of the head and neck show increased levels of nucleotide excision repair protein XPF in vivo that correlate with increased chemoresistance ex vivo PMID: 20372803
  43. Studies indicate that a marginally statistically significant association was found for XRCC1 codon 399, XPD Asp312Asn and XRCC1 codon 194 variants and head and neck cancer. PMID: 20429839
  44. XPF promoter -357A>C polymorphism may regulate the expression of XPF and thereby contribute to susceptibility to and prognosis of bladder cancer. PMID: 20062074
  45. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20201926
  46. XPF protein has important roles in psoralen ICL-mediated DNA repair and mutagenesis. PMID: 14728600
  47. the ternary complex of hRad52 and XPF/ERCC1 is the active species that processes recombination intermediates generated during the repair of DNA double strand breaks and in homology-dependent gene targeting events PMID: 14734547
  48. We show that RAD1 is an essential gene for sustained cell proliferation and that loss of Rad1 causes destabilization of Rad9 and Hus1 and consequently disintegration of the sliding-clamp complex. PMID: 15184880
  49. XPF is required to form gamma-H2AX and likely double strand breaks in response to interstrand crosslinks in human cells PMID: 16678501
  50. A SNP (rs744154) in intron 1 was associated with recessive protection from breast cancer after adjustment for multiple testing in stage 2. It is in the first intron, in a region that is highly conserved across species, and could be causal. PMID: 17018596

Show More

Hide All

Involvement in disease
Xeroderma pigmentosum complementation group F (XP-F); XFE progeroid syndrome (XFEPS); Xeroderma pigmentosum type F/Cockayne syndrome (XPF/CS); Fanconi anemia complementation group Q (FANCQ)
Subcellular Location
Nucleus.
Protein Families
XPF family
Database Links

HGNC: 3436

OMIM: 133520

KEGG: hsa:2072

STRING: 9606.ENSP00000310520

UniGene: Hs.567265

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*