Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
Deoxyribonuclease gamma; Deoxyribonuclease I like 3; Deoxyribonuclease I like III; Deoxyribonuclease I-like 3; DHP 2; DHP2; DNAS1L3; DNase gamma; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I like 3; DNase I-like 3; DNASE1L3; DNSL3_HUMAN; Liver and spleen DNase; LS DNase; LS-DNase; LSD; SLEB 16; SLEB16
Species
Homo sapiens (Human)
Expression Region
21-305aa
Target Protein Sequence
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The synthesis of this Recombinant Human DNASE1L3 protein depends on the utilization of recombinant DNA technology to a large degree. DNA sequences that encoded the DNASE1L3 protein could be inserted into a vector and introduced into an expression host, E.coli, where it could be easily expressed in and purified from. The expression of this DNASE1L3 protein was at 21-305aa. The purity is 85%+ determined by SDS-PAGE.
DNASE1L3 is a gene providing an instruction of making a protein named deoxyribonuclease gamma (DNASE1L3) in human. The protein encoded by this gene is also known as DNase I homolog protein DHP2, deoxyribonuclease I-like 3 (DNase I-like 3), liver and spleen DNase (LS-DNase or LSD). The encoded protein is an enzyme with deoxyribonuclease and deoxyribonuclease I activity. The protein is involved in multiple biological processes, including apoptotic DNA fragmentation, DNA catabolic process, regulation of acute inflammatory response and neutrophil mediated cytotoxicity. Validation results from multiple databases showed low expression of DNASE1L3 in colon cancer.