Recombinant Human Deoxyribonuclease gamma (DNASE1L3)

In Stock
Code CSB-EP621686HUe1
MSDS
Size US$472
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Deoxyribonuclease gamma; Deoxyribonuclease I like 3; Deoxyribonuclease I like III; Deoxyribonuclease I-like 3; DHP 2; DHP2; DNAS1L3; DNase gamma; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I like 3; DNase I-like 3; DNASE1L3; DNSL3_HUMAN; Liver and spleen DNase; LS DNase; LS-DNase; LSD; SLEB 16; SLEB16
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
21-305aa
Target Protein Sequence
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
33.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The synthesis of this Recombinant Human DNASE1L3 protein depends on the utilization of recombinant DNA technology to a large degree. DNA sequences that encoded the DNASE1L3 protein could be inserted into a vector and introduced into an expression host, E.coli, where it could be easily expressed in and purified from. The expression of this DNASE1L3 protein was at 21-305aa. The purity is 85%+ determined by SDS-PAGE.

DNASE1L3 is a gene providing an instruction of making a protein named deoxyribonuclease gamma (DNASE1L3) in human. The protein encoded by this gene is also known as DNase I homolog protein DHP2, deoxyribonuclease I-like 3 (DNase I-like 3), liver and spleen DNase (LS-DNase or LSD). The encoded protein is an enzyme with deoxyribonuclease and deoxyribonuclease I activity. The protein is involved in multiple biological processes, including apoptotic DNA fragmentation, DNA catabolic process, regulation of acute inflammatory response and neutrophil mediated cytotoxicity. Validation results from multiple databases showed low expression of DNASE1L3 in colon cancer.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has DNA hydrolytic activity. Is capable of both single- and double-stranded DNA cleavage, producing DNA fragments with 3'-OH ends. Can cleave chromatin to nucleosomal units and cleaves nucleosomal and liposome-coated DNA. Acts in internucleosomal DNA fragmentation (INDF) during apoptosis and necrosis. The role in apoptosis includes myogenic and neuronal differentiation, and BCR-mediated clonal deletion of self-reactive B cells. Is active on chromatin in apoptotic cell-derived membrane-coated microparticles and thus suppresses anti-DNA autoimmunity. Together with DNASE1, plays a key role in degrading neutrophil extracellular traps (NETs). NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens during inflammation. Degradation of intravascular NETs by DNASE1 and DNASE1L3 is required to prevent formation of clots that obstruct blood vessels and cause organ damage following inflammation.
Gene References into Functions
  1. The authors found a significant reduction in serum DNase1l3 level in dermatomyositis/polymyositis and systemic lupus erythematosus, which may associate with clinic features and disease activity. PMID: 28039554
  2. Data indicate a likely functional variant influencing scleroderma susceptibility at deoxyribonuclease I-like 3 protein DNASE1L3 missense polymorphism rs35677470. PMID: 25332064
  3. Single nucleotide polymorphisms in the DNASE1L3 is associated with autoimmune diseases. PMID: 24206041
  4. DNASE1L3 mutations occur in hypocomplementemic urticarial vasculitis syndrome. PMID: 23666765
  5. We identified a rare autosomal recessive form of systemic lupus erythematosus, in which autozygome analysis revealed a null mutation in the DNASE1L3 gene PMID: 22019780
  6. investigates the distribution of DNASE1L3 gene SNPs in exons of the gene in eight Asian, three African, and three Caucasian populations worldwide using newly devised genotyping methods. PMID: 21692081
  7. The Poly(ADP-ribose) polymerase-1-regulated endonuclease DNAS1L3 is required for etoposide-induced internucleosomal DNA fragmentation and increases etoposide cytotoxicity in transfected osteosarcoma cells. PMID: 12154052
  8. Identification of two functional nuclear localization signals in DNase gamma that have a role in apoptotic DNA fragmentation. PMID: 12943533
  9. DNase gamma is involved in the generation of resected double-strand DNA breaks associated with somatic hypermutation PMID: 15629432
  10. DNAS1L3 plays an active role in lymphoma cell sensitization to VP-16 and its deficiency may constitute a novel mechanism of drug resistance in these cells PMID: 16427601
  11. A Caucasian-specific allele in SNP R206C produces an inactive form of DNase Il3. PMID: 19559017
  12. Results distinguish DNase gamma-dependent and CAD/DFF40-dependent DNA fragmentations, and show that even if DNA fragmentation is initiated by CAD/DFF40, DNase gamma is required for the more complete digestion of the genomic DNA in dying cells. PMID: 19574717

Show More

Hide All

Involvement in disease
Systemic lupus erythematosus 16 (SLEB16)
Subcellular Location
Nucleus. Endoplasmic reticulum. Secreted.
Protein Families
DNase I family
Tissue Specificity
Liver and spleen.
Database Links

HGNC: 2959

OMIM: 602244

KEGG: hsa:1776

STRING: 9606.ENSP00000316193

UniGene: Hs.476453

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*