Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
Deoxyribonuclease gamma; Deoxyribonuclease I like 3; Deoxyribonuclease I like III; Deoxyribonuclease I-like 3; DHP 2; DHP2; DNAS1L3; DNase gamma; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I like 3; DNase I-like 3; DNASE1L3; DNSL3_HUMAN; Liver and spleen DNase; LS DNase; LS-DNase; LSD; SLEB 16; SLEB16
Species
Homo sapiens (Human)
Expression Region
21-305aa
Target Protein Sequence
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The cDNA fragment encoding 21-305aa of Human Deoxyribonuclease gamma (DNASE1L3) was fused with an N-terminal GST-tag and then expressed in E.coli. The product obtained is the recombinant full-length of mature human DNASE1L3 protein. Its purity was determined by using SDS-PAGE and reached up to 90%. Under the reducing conditions, the gel presented a molecular mass band of about 62 kDa. The slightly higher result was attributed to glycosylation. It was also validated by the LC-MS/MS analysis. In-stock DNASE1L3 proteins are offered now. This recombinant DNASE1L3 protein may find uses in the specific antibody generation or the studies of cell biology.
DNASE1L3 is a secreted DNASE1-like nuclease, which can digest DNA in chromatin. The deletion of DNASE1L3 can cause anti-DNA responses and autoimmunity in humans and mice. Lee Serpas et al. proved that DNASE1L3 plays a role in circulating plasma DNA homeostasis by enhancing fragmentation and affecting terminal motif frequencies. These results support the unique role of DNASE1L3 as a regulator of physical form and cell-free DNA availability, which may be significant for the DNASE1L3's mechanism of preventing autoimmunity.