Recombinant Human Diablo homolog, mitochondrial (DIABLO)

In Stock
Code CSB-EP865113HU
Abbreviation Recombinant Human DIABLO protein
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
0610041G12Rik; DBLOH_HUMAN; DBOH; DFNA64; diablo; Diablo homolog (Drosophila); Diablo homolog; Diablo homolog mitochondrial ; Diablo IAP binding mitochondrial protein; Diablo like protein; DIABLO S; Direct IAP binding protein with low pI ; Direct IAP-binding protein with low pI; FLJ10537; FLJ25049; mitochondrial; Mitochondrial Smac protein ; Second mitochondria derived activator of caspase ; Second mitochondria-derived activator of caspase; second mitochondrial activator of caspases; SMAC 3; Smac; Smac protein; SMAC3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
56-239aa
Target Protein Sequence
AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Synthesizing the recombinant Human DIABLO protein generally involves integrating the DNA fragment that encodes the Human DIABLO protein (56-239aa) into a plasmid, introducing the recombinant plasmid into e.coli cells, followed by the selection and culturing of positive e.coli cells, induction of protein expression, and subsequent cell lysis. A N-terminal GST tag is fused to the protein. The protein is purified through affinity purification, and SDS-PAGE analysis is conducted to confirm the presence of the protein and determine its purity. The protein's purity surpasses 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Inhibits the activity of BIRC6/bruce by inhibiting its binding to caspases. Isoform 3 attenuates the stability and apoptosis-inhibiting activity of XIAP/BIRC4 by promoting XIAP/BIRC4 ubiquitination and degradation through the ubiquitin-proteasome pathway. Isoform 3 also disrupts XIAP/BIRC4 interacting with processed caspase-9 and promotes caspase-3 activation. Isoform 1 is defective in the capacity to down-regulate the XIAP/BIRC4 abundance.
Gene References into Functions
  1. Mechanistic studies showed that Smac can inhibit the expression of Survivin, promote cell apoptosis of drug-resistant ovarian cancer cells and reverse the drug resistance. PMID: 29562492
  2. Serum Smac expression level was significantly lower in the EAOC group than in the control group and benign ovarian tumor group (P< 0.05), while HE4 and CA125 expression levels were significantly higher in the EAOC group than the other two groups. PMID: 29226858
  3. SMAC expression in locally advanced breast cancer is a novel favourable prognostic factor in LABC for pathological complete remission and disease-free survival. PMID: 29895124
  4. administration of SMAC or BH3 mimetics following short-term paclitaxel treatment could be an effective therapeutic strategy for TNBC, while only BH3-mimetics could effectively overcome long-term paclitaxel resistance. PMID: 28187446
  5. Antagonism strategies to modulate the actions of XIAP, cIAP1/2 and survivin are the central focus of current research and this review highlights advances within this field with particular emphasis upon the development and specificity of second mitochondria-derived activator of caspase (SMAC) mimetics (synthetic analogs of endogenously expressed inhibitors of IAPs SMAC/DIABLO). PMID: 28424988
  6. analysis of Smac-mediated apoptosis in chronic lymphocytic leukemia cells PMID: 27223062
  7. Data show that oncolytic viruses (OV) and second mitochondrial activator of caspase (Smac)-mimetic compounds (SMC) synergistically kill cancer cells directly. PMID: 28839138
  8. Expressions of SDF-1, survivin and smac were significantly higher in epithelial ovarian cancer tissue than those in normal tissue. PMID: 28852723
  9. Results indicate that Smac plays an important role in reticulum stress-induced apoptosis in human lens epithelial cells, suggesting its close association with cataract development. PMID: 28682901
  10. Smac mimetic APG-1387 exerts a potent antitumor effect on nasopharyngeal carcinoma cells by inducing apoptosis. PMID: 27424523
  11. Study found a negative correlation between Smac and XIAP at the level of protein but not mRNA in non-small cell lung carcinoma (NSCLC) patients. Overexpressed XIAP could degrade through ubiquitination, the mature Smac inhibiting NSCLC apoptosis. PMID: 27498621
  12. Report role of RIP1 in Smac mimetic mediated chemosensitization of neuroblastoma cells. PMID: 26575016
  13. This review discusses the promise as well as some challenges at the translational interface of exploiting Smac mimetics as cancer therapeutics. PMID: 26567362
  14. Data indicate that Smac/DIABLO showed an inverse correlation with inhibitor of apoptosis proteins XIAP, cIAP-1 and cIAP-2. PMID: 25549803
  15. Data show that mitochondrial X-linked inhibitor of apoptosis protein (XIAP) entry requires apoptosis regulatory proteins Bax or Bak through mitochondrial permeabilization and Smac/DIABLO protein degradation. PMID: 26134559
  16. SapC-DOPS acts through a mitochondria-mediated pathway accompanied by an early release of Smac and Bax. PMID: 25889084
  17. this is the first demonstration that a dual approach using simultaneous overexpression of a cell penetrable form of Smac and TRAIL sensitize and promote apoptotic process even in resistant breast cancer cells. PMID: 25586349
  18. Preoperative measurement of serum VEGF, survivin, and Smac/DIABLO may be of help in early detection of serous ovarian cancer and may provide important information about the patient's outcome and prognosis. PMID: 25577253
  19. Smac-DIABLO adopts a tetrameric assembly in solution. PMID: 25650938
  20. IRF1 is a dual regulator of BV6-induced apoptosis and inflammatory cytokine secretion. PMID: 25501823
  21. CLIC4, ERp29, and Smac/DIABLO integrated into a novel panel based on cancer stem-like cells in association with metastasis stratify the prognostic risks of colorectal cancer. PMID: 24916695
  22. Within mitochondria, XIAP selectively signals lysosome- and proteasome-associated degradation of its inhibitor Smac. PMID: 25080938
  23. Describe a new alternatively spliced isoform of Smac which promotes thr formation of mammospheres. PMID: 25337193
  24. The phosphorylation of Smac at the Nterminal serine 6 residue is functionally linked to Smac release during TNFalphainduced apoptosis. PMID: 25310587
  25. XIAP, cIAP1, and cIAP2, members of inhibitor of apoptosis (IAP) proteins, are critical regulators of cell death and survival; the SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2 PMID: 24841289
  26. It represents a powerful way to enhance the destruction of cancer cells and increase the efficiency and duration of gene expression required for apoptosis. PMID: 24771354
  27. Over-expression of cellular Smac can inhibit inhibitor of apoptosis proteins (IAPs), enhance caspases activity and the apoptosis rate of PC-3 cells induced by TRAIL, which may provide a useful experimental basis for prostate cancer therapy. PMID: 22528226
  28. The present study indicated the significance of Smac and survivin in determining the breast cancer response to anthracyclinebased chemotherapy, and may permit further stratifying of prechemotherapy patients to undertake more tailored treatments. PMID: 24317109
  29. Smac/DIABLO decreases the proliferation and increases the apoptosis of hypertrophic scar fibroblasts. PMID: 23857156
  30. Results show that Smac mimetics exerts an antitumor effect on nasopharyngeal carcinoma cancer stem cells. PMID: 23699656
  31. We report that an Smac-mimetic selectively induces TNF-alpha-dependent cystic renal epithelial cell death, leading to the removal of cystic epithelial cells from renal tissues and delaying cyst formation. PMID: 23990677
  32. The activin A signals via SMAD proteins, but not TAK1 or p38, to regulate murine and ovine Fshb transcription in gonadotrope-like cells. PMID: 22549017
  33. Results demonstrate an essential and apoptosis-independent function of SMAC in tumor suppression and provide new insights into the biology and targeting of colon cancer. PMID: 22751125
  34. Overexpression of Smac promotes Cisplatin-induced apoptosis by activating caspase-3 and caspase-9 in lung cancer. PMID: 23252748
  35. Expressions of SMAC/DIABLO and survivin were significantly reciprocal in breast cancer and benign tumor tissues. PMID: 22161156
  36. Identification of a novel anti-apoptotic E3 ubiquitin ligase that ubiquitinates antagonists of inhibitor of apoptosis proteins SMAC, HtrA2, and ARTS. PMID: 23479728
  37. Smac, XIAP, caspase 3 might be associated with the growth and carcinogenesis of nonnasal inverted papilloma. PMID: 23156805
  38. Higher expression of Smac and Ki-67 appear to play a role in the pathogenesis of pancreatic cancer. Combined detection of these proteins may improve the prognostic evaluation of this disease. PMID: 22534537
  39. differential redistribution of cyt c and Smac occurs under various conditions PMID: 22848756
  40. these data suggest a new mechanism by which NOXA chemosensitized ovarian cancer cells to cisplatin by inducing alterations in the Bax/Smac axis. PMID: 22590594
  41. Overall, the findings suggest that measuring the levels of Smac/DIABLO in the serum may be considered a prognostic parameter in patients with bladder cancer. PMID: 22218530
  42. Data show that the apoptosis rate of Eca109/Smac was significantly increased with the concentration of cispaltin increased. PMID: 22482401
  43. The over-expression of PTEN gene may inhibit the proliferation of K562 cells and promote cell apoptosis via the regulation of Survivin, Xiap and Smac genes. PMID: 22333553
  44. Data show that Smac mimetic- and TNFalpha-mediated cell death occurs without characteristic features of apoptosis (i.e., caspase activation, DNA fragmentation) in FADD-deficient cells. PMID: 22028622
  45. Data suggest that downregulation of Smac may be a chemoresistance mechanism in ESCC. PMID: 21676925
  46. Results establish a critical role of Smac in mediating therapeutic responses of HNSCC cells and provide a strong rationale for combining Smac mimetics with other anticancer agents to treat HNSCC. PMID: 21242120
  47. Low Smac expression is associated with breast cancer. PMID: 21744997
  48. DFNA64 genotype is the human genetic disorder associated with DIABLO malfunction and suggests that mutant DIABLO(S71L) might cause mitochondrial dysfunction. PMID: 21722859
  49. Patients with positive smac/DIABLO tumors had a longer disease-specific survival when compared with those with negative tumors in the 10-year follow-up. PMID: 21478115
  50. The dimerization of Smac is critical for the XIAP-mediated retention of Smac at or inside the mitochondria. PMID: 21354220

Show More

Hide All

Involvement in disease
Deafness, autosomal dominant, 64 (DFNA64)
Subcellular Location
Mitochondrion. Note=Released into the cytosol when cells undergo apoptosis.
Tissue Specificity
Ubiquitously expressed with highest expression in testis. Expression is also high in heart, liver, kidney, spleen, prostate and ovary. Low in brain, lung, thymus and peripheral blood leukocytes. Isoform 3 is ubiquitously expressed.
Database Links

HGNC: 21528

OMIM: 605219

KEGG: hsa:56616

STRING: 9606.ENSP00000398495

UniGene: Hs.169611

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*