Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
0610041G12Rik; DBLOH_HUMAN; DBOH; DFNA64; diablo; Diablo homolog (Drosophila); Diablo homolog; Diablo homolog mitochondrial ; Diablo IAP binding mitochondrial protein; Diablo like protein; DIABLO S; Direct IAP binding protein with low pI ; Direct IAP-binding protein with low pI; FLJ10537; FLJ25049; mitochondrial; Mitochondrial Smac protein ; Second mitochondria derived activator of caspase ; Second mitochondria-derived activator of caspase; second mitochondrial activator of caspases; SMAC 3; Smac; Smac protein; SMAC3
Species
Homo sapiens (Human)
Expression Region
56-239aa
Target Protein Sequence
AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Synthesizing the recombinant Human DIABLO protein generally involves integrating the DNA fragment that encodes the Human DIABLO protein (56-239aa) into a plasmid, introducing the recombinant plasmid into e.coli cells, followed by the selection and culturing of positive e.coli cells, induction of protein expression, and subsequent cell lysis. A N-terminal GST tag is fused to the protein. The protein is purified through affinity purification, and SDS-PAGE analysis is conducted to confirm the presence of the protein and determine its purity. The protein's purity surpasses 85%.