Recombinant Human Diamine acetyltransferase 1 (SAT1)

Code CSB-EP020717HU1
Abbreviation Recombinant Human SAT1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
SAT1
Uniprot No.
Research Area
Metabolism
Alternative Names
DC21; Diamine acetyltransferase 1; Diamine N acetyltransferase 1; EC 2.3.1.57; KFSD; KFSDX; Polyamine N acetyltransferase 1; Polyamine N-acetyltransferase 1; Putrescine acetyltransferase; SAT; SAT1; SAT1_HUMAN; Spermidine/spermine N(1) acetyltransferase 1; Spermidine/spermine N(1)-acetyltransferase 1; Spermidine/spermine N1 acetyltransferase 1; Spermidine/spermine N1 acetyltransferase alpha; SSAT 1; SSAT; SSAT-1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
5-171aa
Target Protein Sequence
VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are interested in Recombinant Human Diamine acetyltransferase 1(SAT1), product code: CSB-RP027544h
We are asking for activity data for this enzyme. Could you please advise?

A:
Thanks for your inquiry. Code: CSB-RP027544h
Name: Recombinant Human Diamine acetyltransferase 1(SAT1)
Expression Region: 5-171aa; Full Length of Mature Protein
Tag Info: N-terminal GST-tagged
Expression Sequence:

VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE


Product Type: Developed Recombinant Protein
As for the activity, we have not detected it at present. There is no guarantee that the protein is 100% active. The protein we made is only 4 aa at N end less than the full length, which is theoretically active.

Target Background

Function
Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine > putrescine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines. Also involved in the regulation of polyamine transport out of cells. Acts on 1,3-diaminopropane, 1,5-diaminopentane, putrescine, spermidine (forming N(1)- and N(8)-acetylspermidine), spermine, N(1)-acetylspermidine and N(8)-acetylspermidine.
Gene References into Functions
  1. Activation of SAT1 expression induces lipid peroxidation and sensitizes cells to undergo ferroptosis upon reactive oxygen species (ROS)-induced stress, which also leads to suppression of tumor growth in xenograft tumor models. Notably, SAT1 expression is down-regulated in human tumors, and CRISPR-cas9-mediated knockout of SAT1 expression partially abrogates p53-mediated ferroptosis. Moreover, SAT1 induction is correlated PMID: 27698118
  2. our results indicated depletion of polyamines by SSAT signi fi cantly inhibited cell proliferation, migration and invasion through AKT/GSK3beta/beta-catenin signaling pathway in hepatocellular carcinoma and colorectal cancer cells. PMID: 27901475
  3. Extracellular polyamines induced proliferation and cancer cell migration by inducing ODC and SSAT expression, and the Akt1-mediated pathway. PMID: 28157137
  4. we used siRNA on SSAT and compared the SSAT level in knockdown and normal cells. Results showed that the monoclonal antibody specifically recognized SSAT. PMID: 27328064
  5. 4H6 was also compared with the commercial antibody. The produced mAbs will be a useful tool for further investigation of SSAT functions in organisms. PMID: 27228136
  6. Results show low SAT1 brain expression in depressed suicides and implicate low SAT1 brain expression in major depression independent of suicide PMID: 25959060
  7. Data suggest that SAT1 plays role in apoptosis; overexpression of SAT1 in human embryonic kidney cell line leads to a rapid depletion of spermidine and spermine, arrest in cell growth, and mitochondria-mediated apoptosis. PMID: 25849284
  8. Analysis shows a significant direct correlation between SSAT expression in Prostatic Cancer tissues and disease progression. PMID: 25893668
  9. Enhanced SSAT expression by proximal tubule epithelial cells leads to tubular damage, and its deficiency reduces the severity of renal I/R injury through reduction of cellular damage and modulation of the innate immune response PMID: 25390069
  10. A role for SAT1 in homologous recombination. PMID: 25277523
  11. The Catabolic enzyme SSAT expression levels was up-regulated in both cell lines; however, the specific SSAT siRNA treatments prevented the EBR-induced apoptosis only in LNCaP (AR+) cells. PMID: 23963538
  12. In females, the TC genotype was significantly more frequent in alcohol-dependent patients than in non-alcohol-dependent psychiatric controls. No differences were found among the males. PMID: 24735382
  13. study postulates a mechanism for SAT1 and SMOX down-regulation by post-transcriptional activity of miRNAs. PMID: 24025154
  14. SAT1 transcription is influenced by lithium and this effect is altered in bipolar disease patients who completed suicide. PMID: 23768751
  15. berberine inhibits cellular growth by affecting polyamine metabolism, in particular through the upregulation of the key catabolic enzyme, spermidine/spermine N1-acetyltransferase (SSAT). PMID: 23903781
  16. EBV-positive Akata cells demonstrated decreased SAT1 enzyme activity concomitant with altered intracellular polyamine level. PMID: 23891576
  17. SSAT translational control mechanisms PMID: 22354986
  18. SSAT induction plays a role in cell detachment and apoptosis of glioblastoma cells by N1,N11-diethylnorspermine treatment. PMID: 22179681
  19. The results of this study indicated that epigenetic factors in the promoter region of SAT1 influence gene expression levels, and may provide a mechanism for both our previous findings of haplotype-specific effects of promoter variations on SAT1 expression PMID: 21501848
  20. Studies indicate that each of the 4 genes was associated with at least one main outcome: anxiety (SAT1, SMS), mood disorders (SAT1, SMOX), and suicide attempts (SAT1, OATL1). PMID: 21152090
  21. SSAT1 may regulate exogenous gene expression by blocking steps involved in transcription/translation from an episomal vector by targeting non-polyamine substrate(s) critical for this pathway PMID: 20212040
  22. These results add support for a role of SAT1 in conferring a risk for suicide completion, in particular in the context of depressive disorders. PMID: 19851986
  23. Knockdown studies suggest that induction of SSAT and SMO is correlated with the antiproliferative effects of BENSpm with 5-FU or paclitaxel in MDA-MB-231 cells. PMID: 19727732
  24. Induction of alternatively spliced spermidine/spermine N1-acetyltransferase mRNA in the human kidney cells infected by venezuelan equine encephalitis and tick-borne encephalitis viruses PMID: 12083816
  25. overexpression of SSAT and the consequent putrescine accumulation are involved in the keratosis follicularis spinulosa decalvans phenotype PMID: 12215835
  26. characterization of promoter function in Hela cells by study of a factor, bound to the responsive element, that underwent modification by binding with another factor after X-ray irradiation PMID: 12427553
  27. genomic identification and biochemical characterization of an isoenzyme PMID: 12803540
  28. SSAT has a role in apoptosis induced by sulindac sulfone, which leads to reduced tissue polyamine contents in human colon cancer cells PMID: 14506281
  29. Transgenic SSAT-overexpressing mice are less active than syngeneic mice and show reduced aggressive behavior; furthermore, SSAT-OE mice have reduced muscle tone and grip strength, although they do not differ from syngeneic mice in several agility tasks. PMID: 15159132
  30. SSAT has a role in kidney ischemia-reperfusion injury PMID: 15213272
  31. spermidine acetyltransferase directly binds to the alpha9 cytoplasmic domain and mediates alpha9-dependent enhancement of cell migration PMID: 15479742
  32. Restoring high inducibility of SSAT activity subverts the reduced sensitivity to cisplatin of SSAT-deficient ovarian cancer cells. PMID: 15905201
  33. SSAT and SMO(PAOh1) activities are the major mediators of the cellular response of breast tumor cells to polyamines while PAO plays little or no role in this response PMID: 16207710
  34. Activation of SSAT by aspirin and different NSAIDs may be a common property of NSAIDs that plays an important role in their chemopreventive actions in colorectal cancer. PMID: 16262603
  35. tertiary structure of hSSAT reported in this article provides a sound basis for the in-depth study of its structure-function relationship PMID: 16544326
  36. The inhibition of IkappaB and activation of NFkappaB activate SSAT. PMID: 16637064
  37. a common mediator of inflammation can lead to the induction of SSAT expression by activating the NFkappaB signaling pathway in non-small cell lung cancer cells PMID: 16757480
  38. These results indicate that the disruption of polyamine homeostasis due to enhanced SSAT activity leads to DNA damage and reduced cell proliferation via activation of DNA repair and cell cycle checkpoint and disruption of Raf --> MEK --> ERK pathways. PMID: 17065202
  39. The structure of the SSAT-spermine-acetyl-coenzyme A complex suggested that Tyr140 acts as general acid and Glu92, through one or more water molecules, acts as the general base during catalysis. PMID: 17516632
  40. SSAT1, which shares 46% amino acid identity with SSAT2, also binds to HIF-1alpha and promotes its ubiquitination/degradation. However, in contrast to SSAT2, SSAT1 acts by stabilizing the interaction of HIF-1alpha with RACK1 PMID: 17875644
  41. Adenovirus-mediated expression of SSAT inhibits colorectal cancer cell growth in vitro. PMID: 18430370
  42. interaction between SLC3A2 and SAT1 suggests that these proteins may facilitate excretion of acetylated polyamines. PMID: 18660501
  43. This is the first study linking polymorphic variants of genes involved in polyamine metabolism with anxiety disorders. PMID: 18759322
  44. Our study provides new results which show that dysregulation of SSAT expression does play a role in suicide behavior. PMID: 19051286
  45. Downregulation of SAT1 expression may play a role in depression and suicidality. PMID: 19152344
  46. We failed to demonstrate a significant association between the SAT-1 single nucleotide polymorphism and schizophrenia PMID: 19162121
  47. results indicate that specific promoter variants in SAT1 have an effect on SAT1 gene expression. PMID: 19446796
  48. Adenovirus vector-mediated upregulation of spermidine /spermine N1-acetyltransferase impairs human gastric cancer growth in vitro and in vivo. PMID: 19686286

Show More

Hide All

Involvement in disease
Keratosis follicularis spinulosa decalvans X-linked (KFSDX)
Subcellular Location
Cytoplasm, cytosol.
Protein Families
Acetyltransferase family
Database Links

HGNC: 10540

OMIM: 308800

KEGG: hsa:6303

STRING: 9606.ENSP00000368572

UniGene: Hs.28491

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*