Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial,Escherichia Coli

Code CSB-EP006852HU
MSDS
Size US$88
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
DHODH
Uniprot No.
Research Area
Metabolism
Alternative Names
DHOdehase; Dhodh; Dihydroorotate dehydrogenase (quinone); Dihydroorotate dehydrogenase; Dihydroorotate dehydrogenase mitochondrial; Dihydroorotate oxidase; Human complement of yeast URA1; mitochondrial; POADS; PYRD_HUMAN; URA1
Species
Homo sapiens (Human)
Source
E.coli
Mol. Weight
43.6kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Please:
1. Can you please advise the lead time for CSB-EP006852HU.
2. After cusabio as synthesized a batch of protein how is it stored?
3. Is the protein active?

A:
Very nice to receive your inquiry. The product details are confirmed as below.
1. General Information
Code: CSB-EP006852HU1
Name: Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH),partial
Expression System: E.coli
Expression Region: 31-395aa, Partial
Tag Info: N-terminal 6xHis-tagged
Expression Sequence:

TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR


2. For liquid form, we will add glycerole and store protein at -20℃/-80℃. For lyophilized powder, we will store at -20℃.
3. We haven't tested the activity and haven't received any feedback from our customer. There is literature reporting that the fragment (human, rat, mouse) expressed in E. coli all have activity.
Meanwhile, this literature has mentioned that storage is very important, and the protein will soon lose activity after repeated freeze-thaw.

Target Background

Function
Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.
Gene References into Functions
  1. This case with grossly raised plasma DHO represents the first biochemical confirmation of functional DHODH deficiency. DHO was also easily detectable in dried plasma and blood spots. PMID: 27370710
  2. This is the first study to report on conformational changes of the HsDHODH N-terminal microdomain through a combination of CD and DEER spectroscopic techniques PMID: 26086954
  3. Considering that pyrimidine deficiency alone does not induce craniofacial dysmorphism, the DHODH mutations may contribute to the Miller syndrome in part through somehow altered mitochondrial function. PMID: 23216091
  4. Carriage of a six-marker DHODH haplotype was associated with a reduced treatment response (p = 0.008). PMID: 22966891
  5. The G202A and R346W mutation causes deficient protein stability, and the R135C mutation impairs the substrate-induced enzymatic activity, suggesting that impairment of DHODH activity is linked to the Miller syndrome phenotype. PMID: 22967083
  6. biallelic DHODH mutations in four unrelated families with typical clinical features of Miller syndrome. PMID: 22692683
  7. DHODH inhibition led to a marked decrease in melanoma growth both in vitro and in xenograft studies PMID: 21430780
  8. DHODH recessively causes Miller syndrome. PMID: 20220176
  9. required for N-(4-hydroxyphenyl)retinamide-induced reactive oxygen species production and apoptosis of cancer epithelial cells PMID: 20399851
  10. Data confirmed the presence of DHODH mutations in families with Miller syndrome. PMID: 19915526
  11. biophysical analysis of hydrogen bonding pathways in human dihydroorotate dehydrogenase PMID: 17004840
  12. Data provide new insights into the dynamic features of the DHODH reaction and suggest new approaches to the design of inhibitors against DHODH. PMID: 18672895
  13. DHODH polymorphism may be associated with incireased remiaaion in leflunomide treatment in rheumatoid arthritis patients. PMID: 19207032
  14. we report a new association of DHODH A40C polymorphism with leflunomide toxicity in patients with Rheumatoid Arthritis. PMID: 19605743

Show More

Hide All

Involvement in disease
Postaxial acrofacial dysostosis (POADS)
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Protein Families
Dihydroorotate dehydrogenase family, Type 2 subfamily
Database Links

HGNC: 2867

OMIM: 126064

KEGG: hsa:1723

STRING: 9606.ENSP00000219240

UniGene: Hs.654427

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*