Recombinant Human Dihydropyrimidinase-related protein 1 (CRMP1)

In Stock
Code CSB-EP623907HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP623907HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CRMP1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP623907HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CRMP1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CRMP1
Uniprot No.
Research Area
Neuroscience
Alternative Names
Collapsin response mediator protein 1; CRMP 1; CRMP-1; Crmp1; Dihydropyrimidinase like 1; Dihydropyrimidinase related protein 1; Dihydropyrimidinase-related protein 1; DPYL1_HUMAN; DPYSL1; DRP 1; DRP-1; DRP1; ULIP-3; Ulip3; Unc-33-like phosphoprotein 3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-572aa
Target Protein Sequence
MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
78.2kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

In the general process of expressing the recombinant Human CRMP1 protein, a plasmid encoding the Human CRMP1 protein (1-572aa) is constructed first. The plasmid is transferred into e.coli cells, from which cells containing the plasmid are selected and cultured to express the protein. A N-terminal 6xHis-SUMO tag is fused to the protein. The recombinant Human CRMP1 protein undergoes affinity purification purification and SDS-PAGE analysis. This protein surpasses a purity level of 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance. During the axon guidance process, acts downstream of SEMA3A to promote FLNA dissociation from F-actin which results in the rearrangement of the actin cytoskeleton and the collapse of the growth cone. Involved in invasive growth and cell migration. May participate in cytokinesis.
Gene References into Functions
  1. Study provides a novel insight into the relevance of collapsin response mediator protein 1, a key molecule in semaphorin-3A signaling during neurodevelopment, in the molecular mechanism of action of lithium, and in the pathophysiology of bipolar disorder. PMID: 29666369
  2. Study shows that CRMP1 acts an EMT and metastasis suppressor in prostate cancer cells via its regulation of actin polymerization. PMID: 27321179
  3. Identify CRMP-1 as a novel regulator of actin filament elongation and reveal a surprisingly important role for CRMP-1, EVL, and actin polymerization in maintaining the structural integrity of epithelial sheets. PMID: 28630144
  4. The present study reports that miR-187 was significantly overexpressed in gastric cancer tissues compared to that in non-tumor tissues and was associated with malignant clinical factors such as depth of invasion (P = 0.005), tumor size (P = 0.024), lymph node metastasis . It was found that collapsin response mediator protein 1 (CRMP1), a tumor suppressor, was a direct downstream target of miR-187. PMID: 27864146
  5. miR200a-3p promotes the proliferation of human esophageal cancer cells by post-transcriptionally regulating CRMP1. PMID: 28025999
  6. CRMP1 interacted with Spy1 which would disturb the association of CRMP1 with actin and was involved in the collapse of growth cones induced by Sema3A and regeneration after sciatic nerve crush. PMID: 25526860
  7. These results demonstrate an important role for CRMP-1 in Listeria actin comet tail formation and open the possibility that CRMP-1 controls cell motility by modulating Arp2/3 activation. PMID: 26598519
  8. Human CRMP-1 comprises a tetrameric assembly. PMID: 26249678
  9. Results show that expression of CRMP1 is downregulated in medulloblastoma (MB) tumors. its overexpression inhibits proliferation, migration and invasion of cells suggesting that CRMP1 is implicated in MB pathogenesis. PMID: 26009886
  10. Aberrant upregulation of CRMP-1 expression may link to the mechanism of developing early-onset preeclampsia. PMID: 25194153
  11. CRMP1 targets aggregation-prone, N-terminal HTT fragments and suppresses their spontaneous self-assembly. PMID: 25908449
  12. The mitochondrial fragmentation protein DRP1 play a role in the development of malignant melanoma. PMID: 26032958
  13. in pilocarpine-induced animal model of epilepsy, CRMP-1 dynamically decreased in a range of 2 months. Thus, our results indicate that CRMP-1 may be involved in the development of TLE PMID: 22359051
  14. CRMP1 is a novel candidate protein for schizophrenia traits PMID: 22798627
  15. GSK3beta-dependent phosphorylation of LCRMP-1 provides an important mechanism for regulation of LCRMP-1 on cancer cell invasiveness and clinical outcome. PMID: 22363707
  16. LCRMP-1 and CRMP-1 have opposing functions in regulating cancer cell invasion and metastasis PMID: 21747164
  17. Data demonstrate that CRMP1 tyrosine 504 is a primary target of the Src family of tyrosine kinases (SFKs), specifically Fyn. PMID: 20506281
  18. LCRMP-1 was a cancer invasion enhancer that could be a novel prognostic biomarker in non-small cell lung cancer. PMID: 19362386
  19. CRMP-1 and CRMP-2 have a role in RhoA-dependent signaling, through interaction with and regulation of ROKalpha PMID: 12482610
  20. Collapsin response mediator protein-1: a novel invasion-suppressor gene. PMID: 12650609
  21. CTGF inhibits metastasis and invasion of human lung adenocarcinoma by a CRMP-1-dependent mechanism. PMID: 14996858
  22. CRMP1 and EVC genes are located near WFS1, the Wolfram syndrome type 1 gene. PMID: 15492864
  23. The CRMP1 protein is characterizing as modulators of Wnt protein signaling of Axin-1. PMID: 16169070
  24. GSK3 alters phosphorylation of CRMP-1, -2, and -4 isoforms PMID: 16611631
  25. The collapsin response mediator protein 1 and the promyelocytic leukemia zinc finger protein interact with UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE). PMID: 17118363
  26. Transcription of the invasion suppressor, CRMP-1, is reciprocally regulated at the promoter region by C/EBPalpha and Sp1. PMID: 18524846
  27. ChIP and EMSA demonstrated that p50 binds to a kappaB site residing between -1753 and -1743 of the CRMP-1 promoter region. PMID: 18782567
  28. loss of CRMP1 contribute to the increased invasive phenotype of human Glioblastoma multiforme brain tumors expressing mutant EGFRvIII. PMID: 19903856

Show More

Hide All

Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Cell projection, growth cone. Cytoplasm, cytoskeleton. Perikaryon.
Protein Families
Metallo-dependent hydrolases superfamily, Hydantoinase/dihydropyrimidinase family
Tissue Specificity
Brain.
Database Links

HGNC: 2365

OMIM: 602462

KEGG: hsa:1400

STRING: 9606.ENSP00000321606

UniGene: Hs.135270

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*