Recombinant Human Fatty acid-binding protein, liver (FABP1)

In Stock
Code CSB-BP007940HU
Abbreviation Recombinant Human FABP1 protein
MSDS
Size $317
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
1-127aa
Target Protein Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.2 kDa
Protein Length
Full length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
Gene References into Functions
  1. urinary level associated with the chronic kidney disease classification in HIV-infected patients, but not associated with antiretroviral therapy and tenofovir disoproxil fumarate PMID: 27761670
  2. Both peak oxygen consumption and grip strength were inversely associated with urinary L-FABP levels in middle-aged and older individuals without chronic kidney disease. PMID: 28197733
  3. Nonrenal conditions and systemic severity should be considered for improved AKI prediction by NGAL and L-FABP as biomarkers. PMID: 27605390
  4. urine L-FABP/C is permanently elevated in chronic kidney disease patients. PMID: 28745927
  5. Our data suggests that the polymorphism in genes IL-1beta, IL-1Ra and FABP1 included in this study are not associated with PCOS development, but can influence important biochemical and metabolic parameters in PCOS. PMID: 28405733
  6. On PICU day 1, interleukin-18 predicted acute kidney injury with area under the curve=0.82, but neutrophil gelatinase-associated lipocalin and liver fatty acid binding protein predicted acute kidney injury with area under the curve of less than or equal to 0.69; on PICU day 2, area under the curve was higher. Interleukin-18 and liver fatty acid binding protein on day 1 predicted prolonged acute kidney injury. PMID: 28430754
  7. In total, 68 miRNAs potentially targeting FABP1 were selected; of these, miR-3941, miR-4517, and miR-4672 directly targeted the FABP1 3' untranslated region. Mimics of the three miRNAs substantially repressed FABP1 expression at translational level and led to HepG2 cell resistance to steatosis and cell injury induced by free fatty acids mixture, which rescue of FABP1 overexpression reversed. PMID: 29258109
  8. This study demonstrated that the loss of FABP1 expression is associated with MSI carcinomas and that interferon gamma stimulation plays a role in this process via its interaction with PPARgamma. PMID: 27687006
  9. Hepatic adenomas co-occurring with fibrolamellar carcinomas show LFABP loss and are negative for PRKACA rearrangements, indicating they are genetically distinct lesions. These data also demonstrate that LFABP loss, which characterizes HNF1-alpha inactivation, is a consistent feature of fibrolamellar carcinoma, indicating HNF1-alpha inactivation is an important event in fibrolamellar carcinoma pathogenesis. PMID: 27015136
  10. studies indicate that FABP1 is essential for proper lipid metabolism in differentiated enterocytes, particularly concerning fatty acids uptake and its basolateral secretion. PMID: 28919479
  11. CDH5 and FABP1 expression levels were both elevated in drug-induced liver injury. PMID: 27224670
  12. A high resolution NMR comparative molecular analysis of L-FABP T94T and L-FABP T94A in their unbound states and in the presence of representative ligands of the fatty acid and bile acid classes showed that threonine to alanine replacement did not result in strongly perturbed structural and dynamic features, although differences in oleic acid binding by the two variants were detected. PMID: 28668637
  13. Studies show that despite overall tertiary structure similarity, the hFABP1 differs significantly from rat FABP1 in secondary structure, much larger ligand binding cavity, and affinities/specificities for some ligands. Moreover, while both mouse and hFABP1 mediate ligand induction of PPARA, they differ markedly in genes induced. hFABP1 T94A variant is associated with altered body mass index.[review] PMID: 27117865
  14. analysis of structural, dynamic, and binding properties of the liver fatty acid binding protein (LFABP) in crowded solutions PMID: 27457417
  15. Urinary L-FABP, NGAL, Kim-1 and albumin levels increased during the acute phase of kidney injury and were significantly correlated with the degree of tubulointerstitial fibrosis during the chronic phase. These markers could detect higher risk of progression to CKD. PMID: 27028054
  16. L-FABP was found to associate with VEGFR2 on membrane rafts and subsequently activate the Akt/mTOR/P70S6K/4EBP1 and Src/FAK/cdc42 pathways, which resulted in up-regulation of VEGF-A accompanied by an increase in both angiogenic potential and migration activity. L-FABP significantly promoted tumor growth and metastasis in a xenograft mouse model. PMID: 26919097
  17. In chronic kidney disease, high urinary L-FABP correlated with the development of end-stage renal disease and cardiovascular disease. PMID: 26189083
  18. In the association of SNPs in FABP1 gene with PCOS, rs2197076 was more closely associated with its main features than rs2241883 and seemed to play a more important role in the pathogenesis of PCOS. PMID: 26650609
  19. Report interaction of perfluoroalkyl acids with human liver fatty acid-binding protein. PMID: 25370009
  20. Urinary L-FABP appears to be a sensitive biomarker of acute kidney injury in patients undergoing abdominal aortic repair. PMID: 26585768
  21. Urinary levels of NGAL are more sensitive than uKIM-1 and uL-FABP levels in predicting renal scarring in vesicoureteral reflux. PMID: 26324091
  22. Loss of staining for LFABP appears to be common in hepatocellular carcinoma and may be seen in well-differentiated hepatocellular carcinoma. PMID: 26997447
  23. In this study, the effects of hepatitis B virus X protein (HBx) mediated FABP1 regulation on hepatic steatosis and the underlying mechanism were determined. PMID: 26637457
  24. compared with the rs2919872 G allele, the rs2919872 A allele reduces the transcriptional activity of FABP1 promoter, and thereby may link FABP1 gene variation to triglyceride level in humans. PMID: 26439934
  25. Higher urinary L-FABP was found in pregnant with and without gestational diabetes mellitus(GDM), and considerably higher urinary L-FABP was found in the GDM group compared with the non-GDM group. PMID: 26254248
  26. Multivariable regression analysis revealed that urinary L-FABP and urinary albumin/ creatinine ratio were significantly associated with urinary ACE2 levels. PMID: 26067610
  27. Measurement of uL-FABP levels at 48 h after coronary angiography may be useful in detecting renal damage, and in predicting 1-year renal outcome in ischemic heart disease patients undergoing CAG. PMID: 24554034
  28. Measurement of urinary L-FABP and albumin/creatinine ratio should be useful to assess cardiovascular damage reflecting the elevation of cardiac markers and ECG abnormalities in T2DM with CKD. PMID: 24626813
  29. Urinary L-FABP is strongly associated with anemia in non-diabetic patients. PMID: 26010898
  30. L-FABP is a novel biomarker of diverse kidney diseases. (Review) PMID: 25797895
  31. I-FABP and L-FABP are early markers for abdominal injury with limited prognostic value for secondary organ failures in the post-traumatic course PMID: 25324448
  32. Both the MTP I128T and the L-FABP T94A polymorphisms can affect serum lipid levels in the Chinese population. PMID: 25663234
  33. The study investigates the interaction of L-FAB with phospholipid liposomes. PMID: 25198387
  34. The human FABP1 T94A variant protein had 3-fold higher cholesterol-binding affinity than the WT FABP1. PMID: 25732850
  35. In smaller HCC, L-FABP downregulation probably occurs because of phenotypic changes during tumor progression. Moreover, this downregulation correlated with tumor differentiation and intratumoral inflammation. PMID: 25516669
  36. FABP1 and FABP2 have roles in differentially modulating the activation of PPARalpha in a ligand-selective manner PMID: 25847235
  37. Maternal serum LFABP level appears to be correlated with the severity of the preeclampsia and can be used to confirm the diagnosis. PMID: 25399315
  38. Data suggest that up-regulation of urinary levels of LFABP, KIM1 (kidney injury molecule 1), and NGAL (neutrophil gelatinase associated lipocalin) can be used as biomarkers to reflect tubular dysfunction in early-stage type 2 diabetic nephropathy. PMID: 24687388
  39. There is not a significant association between the FABP1 polymorphisms and aspirin-exacerbated respiratory disease(AERD). PMID: 25338211
  40. Urinary L-FABP was an accurate predictor of early renal allograft function. PMID: 25027586
  41. Increased serum L-FABP levels are associated with delayed graft function. PMID: 24750195
  42. Baseline urinary L-FABP levels can be a predictor for occurrence of contrast-induced kidney disease. PMID: 23604313
  43. L-FABP was downregulated in hepatocellular carcinoma and was associated with poor prognosis. PMID: 25436304
  44. It has investigated the interaction between human L-FABP and the soluble domain of Plasmodium falciparum UIS3 by NMR spectroscopy. PMID: 23169100
  45. NGAL, IL-18, KIM-1, L-FABP, and albumin differed between etiologies and were significantly higher in patients adjudicated with acute kidney injury. PMID: 24375576
  46. Human FABP1 T94A variant impacts fatty acid metabolism and PPAR-alpha activation in cultured human female hepatocytes. PMID: 24875102
  47. although the T94A substitution did not alter the affinity of human L-FABP for long chain fatty acids, it significantly altered human L-FABP structure and stability PMID: 24628888
  48. Data suggest that an SNP in FABP1 (T94A) does not alter affinity of FABP1 for PPARalpha agonists (fibrates); this SNP does alter FABP1 secondary structure, stability, and functional response to fibrates (gene expression up-regulation in hepatocytes). PMID: 24299557
  49. L-FABP was not significantly associated with acute kidney injury in adults or children after adjusting for other kidney injury biomarkers (neutrophil gelatinase-associated lipocalin and IL-18). PMID: 23599408
  50. MS and NMR were used to study the ligand binding of human liver fatty acid binding protein. Results are consistent for 2 binding sites with different affinity; results indicate a higher affinity for oleate relative to palmitate at each binding site. PMID: 23893635

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Database Links

HGNC: 3555

OMIM: 134650

KEGG: hsa:2168

STRING: 9606.ENSP00000295834

UniGene: Hs.380135

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*