Recombinant Human Fibrinogen alpha chain (FGA), partial

Code CSB-YP2621HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP2621HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP2621HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP2621HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP2621HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Fibrinogen alpha chain [Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain] FGA
Species
Homo sapiens (Human)
Expression Region
623-864
Target Protein Sequence
HAKSRPVRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENGVVWVSFRGADYSLRAVRMKIRPLV
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cleaved by the protease thrombin to yield monomers which, together with fibrinogen beta (FGB) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However, subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets via an ITGB3-dependent pathway. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the immune response via both innate and T-cell mediated pathways.
Gene References into Functions
  1. this study shows that hypofibrinogenaemia associated with novel Aalpha126Val-->Asp mutation in the fibrinogen coiled coil PMID: 28816342
  2. All the exons and exon-intron boundaries of fibrinogen genes (FGA, FGB and FGG) were analysed by direct DNA sequencing PMID: 29748775
  3. Taken together, an increased pretreatment plasma fibrinogen level was related to worse survival in digestive system tumors, indicating that it could be a useful prognostic marker in these types of tumors. PMID: 29874984
  4. The risk of early pregnancy loss was significantly higher in women with homozygous or heterozygous FGA: p.Thr331Ala polymorphism than in women with FGA: p.Thr331 (Odds ratio: 8.84, P < .05). PMID: 27099386
  5. Data defined the mutational burden of the fibrinogen FGA, FGB, and FGG genes, and estimated the prevalence of inherited fibrinogen disorders through a systematic analysis of exome/genome data. PMID: 29240685
  6. CD47 expression is decreased on the surface of erythrocytes in obese subjects. These changes in CD47 expression on the erythrocytes surface may be an adaptive response to hyperfibrinogenemia associated with obesity. PMID: 25914268
  7. Fibrinogen A alpha arginine-glycine-aspartate sequence (residues 95-97) is essential for binding to its erythrocyte receptor. PMID: 29662311
  8. Binding of human fibrinogen to MRP enhances Streptococcus suis survival in host blood in a alphaXbeta2 integrin-dependent manner. PMID: 27231021
  9. High fibrinogen level is associated with Type-2 diabetes and diabetic vascular disease. PMID: 28119309
  10. The heterozygous AalphaArg16His and gammaAsp185Asn identified in the study probably underlie the dysfibrinogenemia in this pedigree, with the latter being identified for the first time. PMID: 28425010
  11. Preoperative fibrinogen levels appeared as an independent mortality risk factor in non-metastatic colorectal cancer patients with normal GPS scores PMID: 28269756
  12. evidence that VLITL confers amyloidogenic properties to Aalpha-chain frameshift variants, yielding a previously unknown molecular basis for the pathogenesis of Aalpha-chain amyloidosis PMID: 29089309
  13. We used mass spectrometry of plasma from trauma patients to find that fibrinogen Aalpha-C domain methionine sulfoxide content was selectively-increased in patients with coagulopathy vs. those without coagulopathy. This evidence supports a novel linkage between oxidative stress, coagulopathy, and bleeding after injury PMID: 27105953
  14. Using a quantum chemical approach method, it has been established that mutations in MMP-10 and FGA proteins led to substantial energetic modifications suggesting an impact on their functions and/or stability in the recurrent pregnancy loss patients. PMID: 29016666
  15. Data indicate that repeated measurement after five hours showed a statistical significant difference for the fractional synthesis rate of fibrinogen but not for albumin. PMID: 28350862
  16. Data indicate only the highest concentration of apixaban was capable to significantly reduce thrombus formation, fibrin association and platelet-aggregate formation. PMID: 28192448
  17. Fibrinogen A alpha-chain amyloidosis appears to be an under-recognized disorder in Braga, Portugal, where we found a high frequency of the FGA p.Glu545Val variant PMID: 28359658
  18. High fibrinogen expression is associated with pancreatic carcinoma. PMID: 28219450
  19. The high preoperative peripheral serum fibrinogen level was related to poor survival in penile cancer patients, suggeting fibrinogen may serve as a powerful predictor of cancer specific survival (CSS) in penile cancer patients. PMID: 27738342
  20. Q237 is rapidly crosslinked first by FXIIIa followed by Q366 and Q328. Both (15)NH4Cl and (15)N-GEE could be crosslinked to the three glutamines in alphaC (233-425) with a similar order of reactivity. No glutamine is dependent on another to react first. Moreover, the remaining two glutamines of each mutant were both still reactive. These glutamines play distinct roles in fibrin crosslinking and clot architecture. PMID: 26951791
  21. The molecular characterization of two novel afibrinogenemic mutations in the fibrinogen A alpha and fibrinogen B beta chain establishes the importance of the A alpha and B beta C-terminal region for normal fibrinogen assembly and secretion. PMID: 27164460
  22. This meta-analysis results did not show significant associations between the polymorphisms in FGA and Ischemic stroke. PMID: 27266621
  23. there was a relatively high frequency of pregnancy loss in the setting of the FGA Thr312Ala polymorphism. PMID: 26139837
  24. Fibrinogen was significantly increased in pediatric patients with complicated appendicitis compared to patients with uncomplicated appendicitis or non-specific abdominal pain. PMID: 27760719
  25. No association between three single nucleotide polymorphisms in the fibrinogen alpha gene and schizophrenia. PMID: 28203040
  26. Fibrinogen Shanghai results in N-terminal truncation of Aalpha chain, which does not interfere with synthesis, assembly or secretion of fibrinogen, but compromises fibrin polymerization and clot formation. PMID: 27555433
  27. We found a mutation that consists of a R458C substitution on the fibrinogen alpha chain gene confirmed in 13 new familial subjects that causes a rare subtype of dysfibrinogenemia characterized by venous thromboembolic events PMID: 26581183
  28. Fibrinogen Nijmegen, a mutation at the same position, is causative for thrombosis, whereas fibrinogen Innsbruck appears to lead to a bleeding tendency, illustrating that even mutations at the same position can cause contrary symptoms. PMID: 26540126
  29. Neutrophilic asthma patients and eosinophilic asthma patients had increased fibrinogen compared to controls. PMID: 27044366
  30. To novel fibrinogen mutations have been identified (Aa17GlyalphaCys and Aa381SeralphaPhe) that cosegregate with dysfibrinogenemia in seven family members of a Chinese pedigree. PMID: 26083984
  31. The study reports two novel mutations detected in the FGA and FGB genes in two patients with inherited hypofibrinogenemia. PMID: 25981141
  32. Nutrient overload-induced up-regulation of all three fibrinogen component subunits of the coagulation cascade provides a possible mechanism to explain the excess cardiovascular disease mortality observed in non-alcoholic fatty liver disease patients. PMID: 26256740
  33. No association between cognition and gene polymorphisms involved in thrombosis and haemostasis PMID: 26228839
  34. An analysis of the results obtained in this study and a critical review of previously published data indicate that gene polymorphisms in FGA and FGB are not related to ischemic stroke in children PMID: 25555432
  35. Results support the idea that fibrinogen alphaC regions are involved in the thickening of fibrin fibers. PMID: 25393591
  36. The study identified a 5.9 kDa C-terminal fragment of the fibrinogen alpha chain as an early serum biomarker of fibrogenic processes in patients with liver disease. PMID: 25275549
  37. The Aalpha-Val360 related cross-sectionally to physiologic, radiologic, and symptomatic markers of disease severity of PiZZ alpha1-antitrypsin deficiency. PMID: 25569856
  38. Case Report: hepatocytes homozygous for a large FGA deletion can be genetically modified to restore Aalpha-chain protein expression and secrete a functional fibrinogen hexamer. PMID: 25163824
  39. High plasma D-dimer, fibrinogen, and platelet levels are associated with epithelial ovarian cancer independently of venous thromboembolism. PMID: 25347092
  40. Elevated pre-operative plasma fibrinogen level is associated with aggressive soft-tissue sarcoma. PMID: 24122271
  41. Results show that oxidized fibrinogen, instead of serum albumin (HSA), is the key protein for intermolecular dityrosine formation in plasma. PMID: 25280629
  42. Plasma fibrinogen is an independent predictor for the severity of coronary artery disease in diabetic patients. PMID: 24803720
  43. findings indicate that FGA and SLC6A4 gene interactions may contribute to the phenotypes of ASD rather than the incidence of ASD. PMID: 24192574
  44. role in regulation of clot formation and fibrinolysis PMID: 24048413
  45. Both crude and multivariable regression analyses show that the FGA Thr312Ala polymorphism is a protective factor in the Polish population under dominant and additive models of inheritance. PMID: 24821635
  46. Data indicate that ibrinogen binding to Staphylococcus aureus fibronectin-binding protein A (FnBPA) is sterically regulated by fibronectin binding. PMID: 24627488
  47. Stepwise assembly of fibrinogen is assisted by the endoplasmic reticulum ERp57 lectin-chaperone system in a human hepatocyte cell line. PMID: 24040290
  48. Studies indicate that in afibrinogenemia and hypofibrinogenemia, most mutations of the FGA, FGB, or FGG fibrinogen encoding genes are null mutations. PMID: 23852822
  49. Elevated plasma fibrinogen levels are associated with nonmetastatic colon cancer. PMID: 23612884
  50. These results indicate that DPT can modify certain biological functions of fibrin, and thus a another function of this extracellular matrix protein was revealed. PMID: 23877568

Show More

Hide All

Involvement in disease
Congenital afibrinogenemia (CAFBN); Amyloidosis 8 (AMYL8); Dysfibrinogenemia, congenital (DYSFIBRIN)
Subcellular Location
Secreted.
Tissue Specificity
Detected in blood plasma (at protein level).
Database Links

HGNC: 3661

OMIM: 105200

KEGG: hsa:2243

STRING: 9606.ENSP00000306361

UniGene: Hs.351593

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1