Recombinant Human Fibroblast growth factor 1 (FGF1)

Code CSB-EP008615HUc7
Abbreviation Recombinant Human FGF1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Acidic fibroblast growth factor; aFGF; Beta endothelial cell growth factor; Beta-endothelial cell growth factor; ECGF; ECGF beta; ECGF-beta; ECGFA; ECGFB; Endothelial Cell Growth Factor alpha; Endothelial Cell Growth Factor beta; FGF 1; FGF alpha; Fgf1; FGF1_HUMAN; FGFA; Fibroblast Growth Factor 1 Acidic; Fibroblast growth factor 1; GLIO703; HBGF 1; HBGF-1; HBGF1; Heparin binding growth factor 1; Heparin binding growth factor 1 precursor; Heparin-binding growth factor 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
16-155aa
Target Protein Sequence
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV:ITGB3. Its binding to integrin, subsequent ternary complex formation with integrin and FGFR1, and the recruitment of PTPN11 to the complex are essential for FGF1 signaling. Induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2 and AKT1. Can induce angiogenesis.
Gene References into Functions
  1. Gas5 regulated proliferation and apoptosis in growth plate by controlling FGF1 expression via miR-21 regulation. PMID: 29490650
  2. Modification of the heparin-binding region of FGF1 significantly improves the cardioprotective efficacy, even in the presence of heparin, identifying a novel FGF ligand available for therapeutic use in ischemic heart disease. PMID: 29016740
  3. FGF1 protects neuroblastoma cells from p53-dependent apoptosis through an intracrine pathway regulated by FGF1 phosphorylation. PMID: 29048426
  4. Specific heparin derivatives molecular recognition patterns by FGF1 have been reported. PMID: 27858202
  5. Multiple stepwise linear regression analysis found serum level of FGF1 was dependent on anti-diabetic drugs, hemoglobin A1C, body mass index and sex. Serum level of FGF1 is associated with the decreased risk of obesity in human. PMID: 28303556
  6. Our study suggests that the genetic variants of FGF1 rs34011, more so than FGF2 rs2922979, may play a role in PE pathogenesis in Tunisian women. PMID: 27324104
  7. FGF1 and 2 strongly prevent the osteogenic commitment and differentiation of hBMSCs. PMID: 27305863
  8. Transfected FGF1 promotes angiogenic proliferation. PMID: 28281780
  9. These observations suggest a crucial role for cancer-associated fibroblasts and fibroblast growth factor-1/fibroblast growth factor receptor 4 signaling in the progression of ovarian cancer. the expression level of Snail1 and MMP3 was reduced, while the expression level of E-cadherin increased PMID: 28718374
  10. Enzyme-linked immunosorbent assay was used to detect the levels of chemokine (C-X-C motif) ligand 12, chemokine (C-X-C motif) ligand 7, hepatocyte growth factor, and fibroblast growth factor 1 in the supernatants of the laryngeal squamous cell carcinoma and control cells. PMID: 28475003
  11. fibroblast growth factor 1 (FGF1) to be synergistically induced by heat shock and wounding. PMID: 27638903
  12. The results indicate that suramin blocks the interaction between hFGF1 and FGFR2 D2. PMID: 27387234
  13. activation of AurA kinase through FGF1/FGFR signaling axis sustains the stem cell characteristics of glioblastoma cells. PMID: 27138904
  14. Study showed that both aFGF and bFGF were highly expressed in cervical cancer tissues. In tumors of higher clinical stages, the expression of these factors was further enhanced, suggesting that they play a role in facilitating cervical cancer cell proliferation. PMID: 27966750
  15. FGF1 may play a role in the pathogenesis of T2 diabetes mellitus. PMID: 26806193
  16. anti-importin alpha1 antibody treatment suppressed the importin alpha1-FGF1 complex formation and ERK1/2 activation, resulting in decreased cell growth. This study provides novel evidence that functional importin alpha1 is located at the cell surface, where it accelerates the proliferation of cancer cells. PMID: 26887791
  17. The mutational introduction of a novel Cys residue (Ala66Cys) that forms a stabilizing disulfide bond (i.e., cystine) with one of the extant Cys residues (Cys83) effectively eliminates one Cys while increasing overall stability. PMID: 27019961
  18. The role of intracellular FGF1 is to protect the cell against stress conditions by providing an additional signal for cell survival, independently of receptor-activated signaling cascades. PMID: 26840910
  19. Data suggest folding of FGF1 is critical for its nonclassical secretion via permeability of lipid bilayer; mutation of proline135 in C-terminus of FGF1 leads to partial unfolding/decrease in FGF1's ability to permeabilize phosphatidylserine bilayers. PMID: 26836284
  20. The analysis identified a signaling axis between FGF signaling and the transcription factor Sox1, which is preferentially expressed in stem- and mesenchymal-like breast cancers. PMID: 26365194
  21. FGF-1 synthesis and secretion by synovial fibroblasts were significantly increased in osteoarthritis. PMID: 26400350
  22. expression of human FGF1 solely in beta-cells in fgf1(-/-) animals prevented overnutrition induced compensatory beta-cell differentiation. PMID: 26420862
  23. Results show that stress functionally associates FGF1 with AHNAK2 and both proteins with the cytoskeleton and their co-localization in the vicinity of the cell membrane. AHNAK2 seems to be an important element of the FGF1 export pathway. PMID: 25560297
  24. These findings suggest that the presence of FGF1 may serve as a prognostic indicator and a potential therapeutic target for non-small cell lung cancer patients, especially for lung squamous cell carcinoma. PMID: 26391572
  25. FGF1 expression is increased in lung from idiopathic pulmonary fibrosis patients. PMID: 26138239
  26. FGF1-FGFR1 axis promotes tongue squamous cell carcinoma metastasis through the epithelial-mesenchymal transition pathway PMID: 26362179
  27. p120RasGAP shields Akt from deactivating phosphatases in FGF1 signaling, but loses this ability once cleaved by caspase-3. PMID: 26109071
  28. Study presents a transcript profiling of remyelinated multiple sclerosis lesions and identified FGF1 as a promoter of remyelination PMID: 25589163
  29. These results suggested that human FGF1B promoter was active in ependymal cells, neurons, and a portion of dopaminergic neurons PMID: 25104610
  30. This review is focused on the role of HDGF in tumorigenesis and metastasis, and provides insight for application in clinical cancer therapy as well as its clinical implications as a prognostic marker in cancer progression. PMID: 25236340
  31. the sulfate in position 6 of d-glucosamine was essential for the mitogenic activity but not for the interaction with FGF-1 PMID: 25015527
  32. While results are awaited from these clinical investigations in squamous NSCLC and other disease settings, additional research is needed to elucidate the role of FGF/FGFR signaling in the biology of NSCLC of different histologies PMID: 24711160
  33. FGF1 gene polymorphism is associated with a lower risk of developing cleft palate or cleft lip in Iranian patients. clet palatot cleft lip PMID: 24613087
  34. precursor of the hormone Irisin (FNCD5) were abundantly expressed in all three fat depots, along with fibroblast growth factors (FGF) FGF1, FGF7 and FGF10, whereas, FGF19 and FGF21 were undetectable. PMID: 23949615
  35. Nucleolin-FGF1 interaction is critical for the intranuclear phosphorylation of FGF1 by PKCdelta and thereby the regulation of nuclear export of FGF1. PMID: 24595027
  36. the genotype distribution of rs34011 within fibroblast growth factor 1 was significantly different between Alzheimer's disease and control group PMID: 24464990
  37. discovery of unexpected, neomorphic insulin-sensitizing action for exogenous non-mitogenic human FGF1 with therapeutic potential for the treatment of insulin resistance and type 2 diabetes PMID: 25043058
  38. By introducing two stabilizing mutations in the C-terminal part of the protein, obtained are variants highly resistant proteolytically with prolonged half-life and enhanced mitogenic activity. PMID: 24304385
  39. Data suggest that the enhanced cell growth was likely due to the electrical stimulation up-regulated secretion of FGF-1 and FGF-2. PMID: 23990967
  40. Both FGF1 and ERBB2 significantly influenced overall survival in breast cancer patients, especially among women with low levels of Native American ancestry. PMID: 23912956
  41. We demonstrate that mesenchymal stromal cells increase FGF-1 secretion on co-culture with Human primary chondrocytes, which, in turn, is responsible for increased Human primary chondrocytes proliferation in pellet co-cultures. PMID: 23557133
  42. FGF1 polymorphism is associated with breast cancer. PMID: 23143756
  43. R50E suppresses angiogenesis induced by FGF1 or FGF2, and thereby indirectly suppresses tumorigenesis, in addition to its possible direct effect on tumor cell proliferation in vivo PMID: 23469107
  44. studied the functional consequences of HSulf-2 activity on fibroblast growth factor (FGF)-induced mitogenesis and found that the enzyme could differentially regulate FGF1 and FGF2 activities PMID: 23457216
  45. The expression of FGF-1 in the in vitro fertilization (IVF) implantation failure group is less than in the fertile group, which suggests that growth factors such as FGF-1 are important maternal factors effecting implantation PMID: 23426545
  46. forms of FGF-1 that enhance thermostability or eliminate buried reactive thiols demonstrate a shorter distribution half-life, a longer elimination half-life, and a longer mean residence time (MRT) in comparison to wild-type FGF-1 PMID: 23133616
  47. The folding transition state of FGF-1 is shown to be highly polarized, with the majority of turns adopting either native-like or denatured-like structure in the folding transition state. PMID: 23047594
  48. LRRC59 facilitates transport of cytosolic FGF1 through nuclear pores by interaction with Kpns and movement of LRRC59 along the ER and NE membranes PMID: 22321063
  49. [review] In this review, the authors discuss recent and ongoing research into the role of fibroblast growth factor and transforming growth factor-beta in the etiopathogenesis of craniosynostosis. PMID: 21806346
  50. Plasticity in interactions of fibroblast growth factor 1 (FGF1) N terminus with FGF receptors underlies promiscuity of FGF1. PMID: 22057274

Show More

Hide All

Subcellular Location
Secreted. Cytoplasm. Cytoplasm, cell cortex. Cytoplasm, cytosol. Nucleus.
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle.
Database Links

HGNC: 3665

OMIM: 131220

KEGG: hsa:2246

STRING: 9606.ENSP00000338548

UniGene: Hs.483635

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*