Recombinant Human Fibroblast growth factor 18 (FGF18)

In Stock Promotion
Code CSB-EP008623HU
MSDS
Size $256
Promotion
A Special Offer on CUSABIO in Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
zFGF5
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
28-207aa
Target Protein Sequence
EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
25.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CUSABIO transfected the expression vector which inserted the recombinant DNA into the E.coli, cultured the cells, and then induced the transcription and translation of the cloned vector. The N-terminal 6xHis tag sequence was appended to the gene coding for the E.coli of the human FGF18 protein to form the recombinant DNA. The recombinant human FGF18 was expressed as N-terminal 6xHis-tagged fusion. The purity of the protein is greater than 90% assayed by SDS-PAGE. It has an apparent molecular weight of approximately 28 kDa.

Fibroblast growth factor-18 (Fgf18) was the extracellular and secreted factor that decreased glycosaminoglycan release and depletion from the cartilage, and enhanced proliferation of articular chondrocytes. In fact, endogenous Fgf18 is known to play an important role in skeletal growth and development because mice lacking Fgf18 exhibit several malformations such as delayed closure of the calvarial sutures, enlargement of the growth plate, and impairment of osteogenic differentiation. Fgf18 has been reported to have anabolic effects on chondrocytes in other cartilaginous tissues like auricular cartilage, bronchial cartilage, and costal cartilage in animal models. These effects seem to be because of the direct action on mature chondrocytes rather than on the progenitor cells. Fgf18 is generally known to activate the IIIc splice variants of FgfR2 and FgfR3, and both of these receptors are known to be expressed in chondrocytes of human and murine articular cartilage.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Have you tested these FGF18 proteins on our website for ELISA kit application?

A:

Please note that the Elisa kit and protein are two separate product lines. The antigen in the Elisa kit is confidential and not for sale. The protein hasn't been tested on the ELISA kit, we can't guarantee it will read well.

Target Background

Function
Plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. Required for normal ossification and bone development. Stimulates hepatic and intestinal proliferation.
Gene References into Functions
  1. FGF18 played an important role in the growth and metastasis of breast cancer. PMID: 29901199
  2. we genotyped rs9313548 and performed case-control-based association analysis with developmental dyslexia in a Chinese population. Our results were in consistent with previous studies as we did not observe significant association of rs9313548 with developmental dyslexia. PMID: 29240020
  3. the suppressive effect of miR-139 on FGF18 and in turn on proliferation, apoptosis, invasion, migration and tumor-induced angiogenesis of HCC cells was investigated. FGF18 was suggested as a prognostic biomarker and therapeutic target in HCC patients and miR-139 may be a promising strategy used in HCC treatment via the suppression of FGF18 PMID: 28765917
  4. the results suggest that FGF18 may be involved in MC3T3E1 cell proliferation and osteoblastic differentiation. PMID: 28765932
  5. significantly increased in endometrioid adenocarinoma PMID: 27267714
  6. FGF9 and FGF18 increased the migratory capacities of human lung fibroblasts, and FGF9 actively modulated matrix metalloproteinase activity in idiopathic pulmonary fibrosis. PMID: 26773067
  7. FGF18 serves an essential role in the growth and migration of non-small cell lung cancer cells by regulating the ERK, p38 signaling pathways and MMP26 protein levels. PMID: 27959447
  8. Data suggest that the combination of FIGO stage, ovarian carcinoma type, and/or fibroblast growth factor 18 (FGF18) score could predict poor prognosis among ovarian carcinoma patients. PMID: 26427667
  9. The position of sulfate ions bound to FGF18 provides insight into the putative HS-binding site and allows comparison with the prototypical FGFs, FGF1, and FGF2. PMID: 24668462
  10. role for FGF-18 in chondrogenic and osteogenic events which drive discal development and ossification of the vertebral bodies. PMID: 23397188
  11. Fgf18 as a molecule that protects articular cartilage by gene expression profiling, and the anticatabolic effects may at least partially be mediated by the Timp1 expression. PMID: 24577103
  12. Tumors from ovarian cancer patients had increased FGF18 expression levels with microvessel density and M2 macrophage infiltration. PMID: 24018557
  13. FGF8, FGF17, and FGF18 are involved in autocrine and paracrine signaling in HCC and enhance the survival of tumor cells under stress conditions, malignant behavior, and neoangiogenesis. PMID: 21319186
  14. There was an association between gene FGF18 rs4043716 and nonsyndromic cleft lip with or without palate in Chinese population. PMID: 19727229
  15. FGF2 and -18 bind to discrete structures on the heparan sulfate chains attached to chondrocyte-derived perlecan which modulate the growth factor activities PMID: 20507176
  16. fibroblast growth factor 18 seems to play a role in maintenance of chondrocyte properties, although its expression was rather high in dedifferentiated chondrocytes. PMID: 19909293
  17. analysis of FGF18 and FGFR5 expression in primary endothelial cells and vascular smooth muscle cells PMID: 16019430
  18. FGF18 is wildly expressed in the cardiovascular tissue. It enhanced cell migration in response to mechanical damage. we detected FGF18 expression in liver vascular and liver sinusoidal endothelial cells (LSECs), but not in hepatic parenchymal cells. PMID: 16756958
  19. FGF18 may play a prominent role in chondrogenesis and osteogenesis during skeletal development and growth (review) PMID: 17128416
  20. FGF3, FGF7, FGF10, FGF18, and FGFR1 may have roles in nonsyndromic cleft lip and palate PMID: 17360555
  21. FGF18 is almost generally over-expressed in colon cancer and exerts pro-tumorigenic effects both in the epithelial and the stromal compartments by stimulating growth and survival of tumour cells, migration of fibroblasts and neovascularization PMID: 17890768

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Database Links

HGNC: 3674

OMIM: 603726

KEGG: hsa:8817

STRING: 9606.ENSP00000274625

UniGene: Hs.87191

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*