Recombinant Human Fibroblast growth factor 5 (FGF5), partial

In Stock
Code CSB-EP008632HUc7
Abbreviation Recombinant Human FGF5 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
FGF-5;Heparin-binding growth factor 5;HBGF-5;Smag-82
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
21-268aa
Target Protein Sequence
HGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.2
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase.
Gene References into Functions
  1. Study indicated that MTHFR rs1801133, FGF5 rs16998073 and CSK rs1378942 were associated with increased the risk of obesity in the Chinese children. PMID: 30217759
  2. FGF5 is an independent protective factor for breast cancer patients. PMID: 29804124
  3. These results provide new insight into the functions of miR-9-3p and HBGF-5 in HCC and identify miR-9-3p as a potential therapeutic target for HCC PMID: 28750499
  4. FGF5 facilitates cell proliferation through ERK1/2 activation, and it influences the osteogenic differentiation of tonsil-derived mesenchymal stem cells. PMID: 27224250
  5. These findings collectively demonstrate a tumor suppressor role of miR-188-5p in HCC progression via targeting FGF5 PMID: 25998163
  6. High BMI increases the effect of the blood pressure-increasing allele at rs1458038 near FGF5 in a Chinese population. PMID: 25618516
  7. In Chinese children, no association of CSK rs1378942, MTHFR rs1801133, CYP17A1 rs1004467, STK39 rs3754777 and FGF5 rs16998073 with BP/risk of hypertension. PMID: 23759979
  8. FGF5 is a crucial regulator of hair growth in humans. PMID: 24989505
  9. Meta-analysis indicated significant associations of both CYP17A1 rs11191548 and FGF5 rs16998073 polymorphisms with hypertension susceptibility in East Asians. PMID: 22959498
  10. Variants in or near FGF5, CYP17A1 and MTHFR contributed to variation in BP and hypertension risk. Effect sizes of these three loci tended to be larger in Chinese than in white Europeans PMID: 20852445
  11. variation in FGF5 and ZNF652 gene upstream regions with altered susceptibility to hypertension in Han Chinese PMID: 20542020
  12. The role of the proteasome is confirmed when a spliced FGF-5 peptide is produced in vitro after incubation of proteasomes with a 49-amino-acid precursor peptide in a transpeptidation splicing model. PMID: 20154207
  13. FGF5 contributes to the malignant progression of human astrocytic brain tumours by both autocrine and paracrine effects. PMID: 18362893

Show More

Hide All

Involvement in disease
Trichomegaly (TCMGLY)
Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Expressed in neonatal brain.
Database Links

HGNC: 3683

OMIM: 165190

KEGG: hsa:2250

STRING: 9606.ENSP00000311697

UniGene: Hs.37055

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*