Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

FGF5

Uniprot No.

P12034

Research Area

Cardiovascular

Alternative Names

(FGF-5)(Heparin-binding growth factor 5)(HBGF-5)(Smag-82)

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

21-268aa

Target Protein Sequence

HGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

62.4 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Do you know if your product recommends adding heparan to the FGF5?

Yes, we recommend adding heparan to the FGF5.

Target Background

Function

Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase.

Gene References into Functions

Study indicated that MTHFR rs1801133, FGF5 rs16998073 and CSK rs1378942 were associated with increased the risk of obesity in the Chinese children. PMID: 30217759
FGF5 is an independent protective factor for breast cancer patients. PMID: 29804124
These results provide new insight into the functions of miR-9-3p and HBGF-5 in HCC and identify miR-9-3p as a potential therapeutic target for HCC PMID: 28750499
FGF5 facilitates cell proliferation through ERK1/2 activation, and it influences the osteogenic differentiation of tonsil-derived mesenchymal stem cells. PMID: 27224250
These findings collectively demonstrate a tumor suppressor role of miR-188-5p in HCC progression via targeting FGF5 PMID: 25998163
High BMI increases the effect of the blood pressure-increasing allele at rs1458038 near FGF5 in a Chinese population. PMID: 25618516
In Chinese children, no association of CSK rs1378942, MTHFR rs1801133, CYP17A1 rs1004467, STK39 rs3754777 and FGF5 rs16998073 with BP/risk of hypertension. PMID: 23759979
FGF5 is a crucial regulator of hair growth in humans. PMID: 24989505
Meta-analysis indicated significant associations of both CYP17A1 rs11191548 and FGF5 rs16998073 polymorphisms with hypertension susceptibility in East Asians. PMID: 22959498
Variants in or near FGF5, CYP17A1 and MTHFR contributed to variation in BP and hypertension risk. Effect sizes of these three loci tended to be larger in Chinese than in white Europeans PMID: 20852445
variation in FGF5 and ZNF652 gene upstream regions with altered susceptibility to hypertension in Han Chinese PMID: 20542020
The role of the proteasome is confirmed when a spliced FGF-5 peptide is produced in vitro after incubation of proteasomes with a 49-amino-acid precursor peptide in a transpeptidation splicing model. PMID: 20154207
FGF5 contributes to the malignant progression of human astrocytic brain tumours by both autocrine and paracrine effects. PMID: 18362893

Hide All

Involvement in disease

Trichomegaly (TCMGLY)

Subcellular Location

Secreted.

Protein Families

Heparin-binding growth factors family

Tissue Specificity

Expressed in neonatal brain.

Database Links

HGNC: 3683

OMIM: 165190

KEGG: hsa:2250

STRING: 9606.ENSP00000311697

UniGene: Hs.37055

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP008632HU
Abbreviation	Recombinant Human FGF5 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Fibroblast growth factor 5 (FGF5), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage