Recombinant Human Fibroleukin (FGL2)

Code CSB-EP619871HU
Abbreviation Recombinant Human FGL2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP619871HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FGL2.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP619871HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FGL2.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
FGL2
Uniprot No.
Research Area
Immunology
Alternative Names
FGL2; FGL2_HUMAN; fibrinogen like 2; Fibrinogen like protein 2; Fibrinogen-like protein 2; Fibroleukin; pT49; T49
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
24-439aa
Target Protein Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I will need to know the concentration of the CSB-EP619871HU-1000 protein.

A:
Thanks for your inquiry. Protein Concentration:
We don't have inventory for this protein at present and have to reproduce this protein. The concentration of previous lot is 0.25mg/ml.
We could guarantee 0.1-2mg/ml protein concentration.

Target Background

Function
May play a role in physiologic lymphocyte functions at mucosal sites.
Gene References into Functions
  1. serum levels of soluble FAS ligand (sFASL) and interferon gamma (IFN-gamma) were analyzed and correlated with sFGL2 levels in Hepatitis C Virus-Infected Patients and Hepatocellular Carcinoma Patients. PMID: 28609212
  2. Data suggest that fibrinogen-like protein 2 (hFGL2) gene silencing via miRNA may be an alternative strategy for the management of hepatocellular carcinoma (HCC). PMID: 27163335
  3. Report increased expression of FGL-2 in peripheral blood mononuclear cells from mycosis fungoides patients. PMID: 27535237
  4. these results suggest that FGL-2 mediates angiogenesis and tumorigenesis not by thrombin-mediated mechanism but rather through FGF-2/ERK signaling pathway. PMID: 25496996
  5. Results show that FGL2 functions as a key immune-suppressive modulator and has potential as an immunotherapeutic target for treating glioblastoma multiforme (GBM). PMID: 25971300
  6. FGL-2 prothrombinase activity in PBMC of lymphoma patients is increased in active disease and normalizes during remission, thus being a potential marker for follow up of lymphoma patients. PMID: 25303152
  7. Studied fibrinogen-like protein 2 expression and its role in CRC metastasis and underlying molecular mechanisms; results suggest that FGL2 plays an important oncogenic role in CRC aggressiveness by inducing EMT. PMID: 25129313
  8. The selected peptide sequence NPG-12 may be a critical domain for hfgl2 prothrombinase activity. PMID: 24728278
  9. The proliferation index of CD8(+)T cells after blocking FGL2 was higher. PMID: 22886967
  10. immunomodulatory activity of FGL2 may be involved in the immunopathogenesis of inflammatory bowel disease PMID: 24287641
  11. Circulating fibrinogen-like protein 2 is increased in patients with systemic sclerosis. PMID: 22983266
  12. Serum fgl2 levels were increased among renal allograft recipients with acute rejection episodes to an extent dependent upon the pathological type and severity of the response. PMID: 23195010
  13. FGL2 contributes to hepatocellular carcinoma tumour growth and angiogenesis in a thrombin-dependent manner, and downregulation of its expression might be of therapeutic significance in HCC. PMID: 22925132
  14. HBV surface antigen-induced transcription of hfgl2 prothrombinase gene. PMID: 22082274
  15. FGL2 plays an important role in macrophage activation in the lungs of COPD patients through MAPK pathway modulation. PMID: 20438701
  16. FGL2 expression may be critical to the pathogenesis of renal allograft rejection; these data provide a rationale for targeting the fgl2 gene in an attempt to modulate allograft rejection. PMID: 15905589
  17. Results suggest that virus-induced fibrinogen-like protein 2 prothrombinase/fibroleukin expression and associated coagulation activity play a pivotal role in initiating severe hepatitis. PMID: 16437596
  18. fgl2 gene transcription induced by the N protein of SARS-CoV was dependent on transcription factor C/EBP alpha binding with its cognate cis-element in fgl2 promoter. PMID: 18390877
  19. Hepatitis B virus-induced hFGL2 transcription is dependent on c-Ets-2 and MAPK signal pathway PMID: 18801734
  20. Human fg12 contributes to the hypercoagulability in cancer and may induce tumor angiogenesis and metastasis via cytokine induction. PMID: 18932275
  21. SARS-CoV N protein specifically modulates transcription of the FGL2 gene to cause fibrosis and vascular thrombosis. PMID: 19423547

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Constitutively expressed in cytotoxic T-cells.
Database Links

HGNC: 3696

OMIM: 605351

KEGG: hsa:10875

STRING: 9606.ENSP00000248598

UniGene: Hs.520989

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*