Recombinant Human Flotillin-2 (FLOT2)

In Stock
Code CSB-EP619868HU
Abbreviation Recombinant Human FLOT2 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Epidermal surface antigen;ESA;Membrane component chromosome 17 surface marker 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-428aa
Target Protein Sequence
GNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles. May be involved in epidermal cell adhesion and epidermal structure and function.
Gene References into Functions
  1. miR-133 involves in lung adenocarcinoma cell metastasis by targeting FLOT2 PMID: 28503944
  2. Results provide evidence that Flot2 plays an important role in the progression of nasopharyngeal carcinoma cells, which may be partially related to its interaction with PLCD3. PMID: 29115528
  3. Flot-2 protein expression was significantly elevated in cancerous tissues and Flot-2 played pivotal roles in the development and progression of cancers. Increased expression of Flot-2 was correlated to a poor prognosis in cancer patients. Review. PMID: 27981826
  4. Data indicate miR-802 as a tumor suppressor in prostate cancer (PCa) progression and elucidated a novel mechanism of the miR-802/Flotillin-2 (Flot2) axis in the regulation of epithelial-mesenchymal transition (EMT), which may be a potential therapeutic target. PMID: 28188157
  5. We demonstrated that LXR stimulation decreases mRNA and protein expression of FLOT2 and DHHC5 in MCF-7 cells. LXR stimulation also reduces Akt phosphorylation and its localization at the plasma membrane PMID: 28739689
  6. Ectopic Flot2 could significantly reverse miR-485-mediated inhibition of metastasis and EMT, demonstrating Flot2 downregulation is involved in function of miR-485 PMID: 27262438
  7. Western blot experiments designed to detect flotillin 2, TMEM256, Rab3B and LAMTOR1 showed that the level of these proteins was higher in urinary exosomes from prostate cancer patients compared to healthy males, and ELISA-based detection of flotillin 2 and PARK7 showed that the combination of these proteins was able to distinguish prostate cancer patients and healthy controls with 68% sensitivity and 93% specificity PMID: 27664330
  8. This study presents the endocytic pathways of internalization for muscarinic type 3 receptor and flotillin-1/2 in salivary gland epithelial cells. knockdown of flot-1 or -2 by flotillin-specific siRNA prevented internalization and reduced the endocytic efficiency of muscarinic type 3 receptor. PMID: 27221048
  9. There was a strong association between polymorphisms of flotillin-2 gene and CAD in the Chinese Han population PMID: 26556629
  10. Flot-2 exerts a pro-neoplastic role in NPC and is involved in tumor progression and metastasis. Moreover, Flot-2 exerts its role through NF-kappaB and PI3K/Akt3 signaling. PMID: 26206082
  11. Positive expression of Flot-2 protein may be an independent biomarker for poor prognosis in oral squamous cell carcinoma. PMID: 26339392
  12. Flot2 is an indispensable member for TGF-beta signaling, which is essential for the epithelial-mesenchymal transition process in nasopharyngeal carcinoma metastasis PMID: 25909165
  13. increased expression of Flot-2 and EGFR in non-small cell lung cancer patients is inversely proportional to the disease prognosis. PMID: 26161893
  14. that miR-449a suppressed Flot2 expression results in decreased cell invasion through repressing TGF-beta-mediated-epithelial-mesenchymal transition PMID: 26576674
  15. Knockdown of FLOT2 decreases breast cancer cell proliferation. Silencing of FLOT2 enhanced the transcriptional activity of FOXO factors by decreasing its phosphorylation through inhibiting the PI3K/Akt signaling pathway. PMID: 25738752
  16. Our findings provided that high FLOT2 expression was associated with poor outcomes in non-small cell lung cancer patients PMID: 25755751
  17. FLOT2 may serve as an oncogene in the development of cervical cancer PMID: 25755754
  18. Flotillin 2 (FLOT2) is a direct target of microRNA-34a and the miR-34a/FLOT2 pathway plays a key role in melanoma proliferation and metastasis. PMID: 25403318
  19. Flotillin-2 is plays a role in the initial steps of skeletal myogenesis. PMID: 25105415
  20. results suggest that the increased expression of Flot-2 protein is a novel higher sensitivity biomarker that can predict lymph node metastases in NPC. PMID: 25014228
  21. Our data suggest that FLOT2 is a novel molecule involved in renal cell carcinoma progression PMID: 25053596
  22. Study suggests the Flot2 protein expression is correlated with cancer progression and poor prognosis in gastric carcinomas, probably due to its role in the regulation of cell proliferation, migration, and invasion in gastric carcinoma cells. PMID: 24854103
  23. The FLOT2 is abundantly expressed in term villous placental CTs and endothelial cells, and in comparison, expression of these proteins in the ST is reduced. PMID: 23064789
  24. Depletion of either flotillin-1 or flotillin-2 resulted in downregulation of ErbB3 and a selective reduction of ErbB2-ErbB3 receptor complexes. PMID: 24747692
  25. Flotillins directly interact with gamma-catenin and regulate epithelial cell-cell adhesion. PMID: 24391950
  26. High FLOT2 protein expression was associated with poor outcomes in patients with breast cancer. PMID: 23945257
  27. We have identified flotillin 1 and 2 as new partners of the cadherin complexes PMID: 24046456
  28. Results identify reggie-1 as a regulator of the Rab11a/SNX4-controlled sorting and recycling pathway. PMID: 23825023
  29. By virtue of its abundant expression in enterocytes, flotillin-2 must have an essential function in intestinal physiology, especially in the colon. PMID: 23983584
  30. Flot2 is an important regulator of mammary tumor-derived lung metastasis PMID: 23146906
  31. a positive correlation exists between flotillin2 and erbB2 expression levels PMID: 23658725
  32. Report role for flotillin 1/2 in interactions of lung epithelial cells with silica nanoparticles. PMID: 22669515
  33. we describe how flotillin-1 and -2 contribute to the stabilization of ErbB2 at the cell surface in breast cancer tissue PMID: 22869152
  34. results support predominant formation of flotillin-1 and -2 hetero-oligomers in resting and chemokine-stimulated human T-cells which may importantly contribute to structuring of the uropod. PMID: 23012365
  35. by promoting EGFR internalization, reggie-1 restricts EGFR signaling involved in E-cadherin macropinocytosis and recycling and regulate adherens junction formation PMID: 22438585
  36. potentially relevant protein substrates of DHHC5 PMID: 22081607
  37. Reggie-1 (flotillin-2) dynamically colocalizes with KIF9 in living cells PMID: 21119006
  38. flotillins have a role in NPC1L1-mediated cholesterol uptake and NPC1L1-flotillins-postive cholesterol-enriched membrane microdomains are involved in the mechanism for efficient cholesterol absorption PMID: 21187433
  39. Studies indicate that spatial link between PrP and the microdomain-forming protein flotillins may contribute to PrP signaling, leading to thelocal assembly of membrane protein complexes at sites involved in cellular communication. PMID: 20515742
  40. In hematopoietic cells, flotillins provide intrinsic cues that govern segregation of certain microdomain-associated molecules during immune cell polarization. PMID: 20027317
  41. Flot-2 overexpression is associated with melanoma progression, with increased PAR-1 expression, and with transformation of SB2 melanoma cells to a highly metastatic line. PMID: 15492257
  42. flotillin-2 identified and immunolocalized in the caveola-vesicle complexes (CVC )present in erythrocytes infected with P. vivax PMID: 16521037
  43. flotillin-2 has a role in lymph node metastasis in melanoma PMID: 17013097
  44. The results showed that flotillin-1 can interact with arginase1, and hence arginase activity was up-regulated by 26.8%. PMID: 17113085
  45. These lines of evidence suggested that a Gq-coupled receptor activates specifically p38 MAPK through lipid rafts and Src kinase activation, in which flotillins positively modulate the Gq signaling. PMID: 17307333
  46. Coassembly of flotillin1 and flotillin2 into microdomains induces membrane curvature, the formation of plasma-membrane invaginations morphologically similar to caveolae, and the accumulation of intracellular vesicles. PMID: 17600709
  47. Reggie-1/flotillin-2 microdomains form independent of actin PMID: 17854803
  48. deletion mutants of reggie-1/flotillin-2 accumulate in the Golgi complex in HeLa and Jurkat cells, suggesting Golgi-dependent trafficking of reggie-1/flotillin-2 PMID: 18237819
  49. Flotillin 2 is a direct transcriptional target of the p53 family member genes in human cancer cells. PMID: 18296650
  50. The interaction of flotillin-2 with amyloid precursor protein (APP) promotes the clustering of APP at the cell surface. PMID: 18337418

Show More

Hide All

Subcellular Location
Cell membrane; Peripheral membrane protein. Membrane, caveola; Peripheral membrane protein. Endosome. Membrane; Lipid-anchor. Note=Membrane-associated protein of caveolae.
Protein Families
Band 7/mec-2 family, Flotillin subfamily
Tissue Specificity
In skin, expressed in epidermis and epidermal appendages but not in dermis. Expressed in all layers of the epidermis except the basal layer. In hair follicles, expressed in the suprabasal layer but not the basal layer. Also expressed in melanoma and carci
Database Links

HGNC: 3758

OMIM: 131560

KEGG: hsa:2319

STRING: 9606.ENSP00000378368

UniGene: Hs.514038

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*