Recombinant Human Folate receptor beta(FOLR2),partial

In Stock
Code CSB-BP008786HU1
Product Type Recombinant Protein
Size US$220Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P14207
Lead Time 3-7 business days
Relevance Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN
Research Area Metabolism
Source Baculovirus
Gene Names FOLR2
Protein Names Folate receptor 2 Folate receptor, fetal/placental Placental folate-binding protein
Expression Region 19-230aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 27.1 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor, Secreted
Protein Families Folate receptor family
Tissue Specificity Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues.
Database Links

HGNC: 3793

OMIM: 136425

KEGG: hsa:2350

STRING: 9606.ENSP00000298223

UniGene: Hs.433159

Pathway Endocytosis

Related Products

FOLR2 Antibodies

FOLR2 Antibodies for Homo sapiens (Human)

FOLR2 Antibodies for Human

FOLR2 Proteins

FOLR2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.