Recombinant Human Forkhead box protein C1 (FOXC1)

In Stock
Code CSB-EP618640HU
Abbreviation Recombinant Human FOXC1 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
FOXC1
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Forkhead-related protein FKHL7;Forkhead-related transcription factor 3;FREAC-3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-553aa
Target Protein Sequence
MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKEPPPPGRQPPPAPPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADSAPPPPAPSAPPPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLALGAYSPGQSSLYSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
62.8 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
DNA-binding transcriptional factor that plays a role in a broad range of cellular and developmental processes such as eye, bones, cardiovascular, kidney and skin development. Acts either as a transcriptional activator or repressor. Binds to the consensus binding site 5'-[G/C][A/T]AAA[T/C]AA[A/C]-3' in promoter of target genes. Upon DNA-binding, promotes DNA bending. Acts as a transcriptional coactivator. Stimulates Indian hedgehog (Ihh)-induced target gene expression mediated by the transcription factor GLI2, and hence regulates endochondral ossification. Acts also as a transcriptional coregulator by increasing DNA-binding capacity of GLI2 in breast cancer cells. Regulates FOXO1 through binding to a conserved element, 5'-GTAAACAAA-3' in its promoter region, implicating FOXC1 as an important regulator of cell viability and resistance to oxidative stress in the eye. Cooperates with transcription factor FOXC2 in regulating expression of genes that maintain podocyte integrity. Promotes cell growth inhibition by stopping the cell cycle in the G1 phase through TGFB1-mediated signals. Involved in epithelial-mesenchymal transition (EMT) induction by increasing cell proliferation, migration and invasion. Involved in chemokine CXCL12-induced endothelial cell migration through the control of CXCR4 expression. Plays a role in the gene regulatory network essential for epidermal keratinocyte terminal differentiation. Essential developmental transcriptional factor required for mesoderm-derived tissues, such as the somites, skin, bone and cartilage. Positively regulates CXCL12 and stem cell factor expression in bone marrow mesenchymal progenitor cells, and hence plays a role in the development and maintenance of mesenchymal niches for haematopoietic stem and progenitor cells (HSPC). Plays a role in corneal transparency by preventing both blood vessel and lymphatic vessel growth during embryonic development in a VEGF-dependent manner. Involved in chemokine CXCL12-induced endothelial cell migration through the control of CXCR4 expression. May function as a tumor suppressor.
Gene References into Functions
  1. This study demonstrates that FOXC1 induces cancer stem cells (CSCs)-like properties in non-small cell lung cancer (NSCLC) by promoting beta-catenin expression. The findings indicate that FOXC1 is a potential molecular target for anti-CSC-based therapies in NSCLC PMID: 30189871
  2. Foxc1 promoted cell proliferation by upregulation PI3K/AKT signaling, which was inflammation-dependent. PMID: 30060822
  3. Knockdown of FOXC1 markedly suppressed cell migration and invasion in vitro, and resulted in downregulation of phosphorylatedRACalpha serine/threonineprotein kinase, protooncogene cMyc and Bcell lymphoma 2. PMID: 29328384
  4. Results provide evidence that FOXC1 is not required for initiation of EMT events but rather participates in the specification of mesenchymal cell phenotype through regulation of FGF receptor switching from FGFR2-IIIb to FGFR1-IIIc in response to TGFb1-induced EMT. PMID: 28684636
  5. In regulating cervical cancers metastasis by targeting FOXC1. PMID: 28810526
  6. Forkhead box C1 protein (FOXC1) promotes melanoma cell function by regulating macrophage stimulating 1 receptor (MST1R) and activating MST1R/PI3K/AKT pathway. PMID: 27533251
  7. expression of FOXC1 in BRCA1 mutant cell lines correlates with sensitivity to olaparib. Whether this is due to rates of proliferation or another mechanism is yet to be explored, but this, and the specificity of FOXC1 in BRCA1-mutant tumors, suggests a possible role for FOXC1 as a marker for targeted therapy. PMID: 27708239
  8. novel EGFR-NF-kappaB-FOXC1 signaling axis that is critical for BLBC cell function PMID: 28629477
  9. Taken together, these data indicate that FOXC1 is a novel hypoxia-induced transcription factor and plays a critical role in tumor microenvironment-promoted lung cancer progression. PMID: 28435457
  10. Genomic analysis of blood and excised valve tissue showed down-regulation of FOXC1 but also FOXC2 expression in the diseased aortic valve. This allows us to speculate on the potential role of FOXC1 in aortic valve anomalies. PMID: 28657660
  11. Results showed a significant higher FOXC1 expression in estrogen receptor-negative breast cancer than that in estrogen receptor-positive. Its overexpression reduced expression of ERalpha and cellular responses to tamoxifen suggesting that FOXC1 regulated expression of ERalpha and affected sensitivity of tamoxifen treatment in breast cancer PMID: 28028927
  12. present work reveals that FOXC1 is an important regulator of exocytosis and establishes a new link between FOXC1 and MYOC-associated glaucoma PMID: 28575017
  13. Glaucoma prevalence and phenotype are characterized in a cohort of glaucoma patients and their family members with FOXC1 variants. PMID: 28513611
  14. FOXC1 and FOXC2 are essential regulators of lymphangiogenesis and may have roles in lymphatic-associated diseases PMID: 27214551
  15. This review will summarize current knowledge on the function and regulation of FOXC1 in tumor development and progression with a focus on basal-like breast cancer, as well as the implications of these new findings in cancer diagnosis and treatment. [review] PMID: 28288141
  16. A novel heterozygous FOXC1 variant segregated with the disease in a family with Axenfeld Rieger Syndrome. A novel homozygous variant in the FOXC1 gene segregated in a family with ARS and congenital glaucoma. PMID: 27463523
  17. Our findings suggested that FOXCUT expression contributed to the development and progression of nasopharyngeal carcinoma by targeting FOXC1 and that FOXCUT might be useful as a potential nasopharyngeal carcinoma biomarker and therapeutic target. PMID: 28635400
  18. this study defines FOXC1 as a regulator specific for KC terminal differentiation and establishes its potential position in the genetic regulatory network. PMID: 27907090
  19. FOXC1 is correlated with chemosensitivity to anthracycline and could be used as an indicator of chemosensitivity in sporadic triple-negative breast cancer PMID: 28493031
  20. Elevated expression of FOXC1 enhanced the invasion ability of BLCB cells in vitro. PMID: 27685901
  21. this report describes an Italian family in which four subjects share brachydactyly type E and a 3 Mb microduplication in region 6p25. The duplication involves the gene FOXC1, expressed during the osteoblast differentiation, which appears a potential candidate gene for brachydactyly. PMID: 28111183
  22. miR-495 acts as a tumour suppressor gene by targeting FOXC1 at the post-transcriptional level in endometrial cancer PMID: 26198045
  23. This report presents the clinical characteristics of a Belgian family with a 3.4 Mb deletion of chromosome 6p25, including the FOXC1 gene. PMID: 27242366
  24. data reveal the presence of translation regulatory sequences in the UTRs of FOXC1 and provide evidence for a possible role of rare FOXC1 variants as modifying factors of goniodysgenesis in primary congenital glaucoma. PMID: 26220699
  25. ARS is an autosomal dominant disorder with high penetration. It is primarily caused by a mutation of the pituitary homeobox 2 (PITX2) or forkhead box C1 (FOXC1) gene. Mutations in PITX2 on chromosome 4q25, or in FOXC1 at 6p25, have been identified in approximately 40% to 70% of patients with ARS PMID: 26240509
  26. These data suggest that deregulation of FOXC1 or its downstream genes play a major role in the pathogenesis of coarctation of the aorta in humans. PMID: 26643481
  27. Disruptions of enhancers near FOXC1 and GMDS may influence brain development. PMID: 26382291
  28. We report a novel FOXC1 mutation (p. R127L) in a three-generation family with three ARS and heart defect patients. PMID: 24914578
  29. FOXC1 directly binds Gli2 and potentiates Gli2 DNA-binding activity. PMID: 26565916
  30. This study shows that hsa-miR548-l regulates FOXC1 translation, contributing to better understand the fine regulation of the biological function of this transcription factor. PMID: 25809640
  31. A meta-analysis of the top SNPs identified three new associated loci in primary open angle glaucoma--TXNRD2, ATXN2, and FOXC1 PMID: 26752265
  32. These findings suggest that miR-4792 functions as a tumor suppressor in NPC development and progression by targeting FOXC1. PMID: 26585487
  33. Our data indicate that miR-138-5p may play an important role in regulating pancreatic cancer cell growth, possibly through targeting FOXC1 PMID: 25875420
  34. The results support that moderate and variable FOXC1 transactivation changes are associated with moderate goniodysgenesis, dominant glaucoma and remarkable phenotypic variability. PMID: 25786029
  35. Foxc1 is essential for progenitor cell development and maintenance of bone marrow niches for these cells upregulating CXCL12 and SCF expression and inhibiting of adipogenic processes in cell progenitors. (Review) PMID: 26049754
  36. In HCC cell lines, IL8 activates expression of FOXC1 via the phosphoinositide 3-kinase signaling to AKT and hypoxia-inducible factor 1alpha. FOXC1 expression leads to transactivation of CXCR1 and CCL2, promoting inflammation and invasivion/metastasis. PMID: 26065367
  37. Report lncRNA FOXC1 upstream transcript (FOXCUT) overexpressed in oral squamous cell carcinoma. PMID: 24889262
  38. We demonstrate that FOXC1 is required for epidermal growth factor-elicited cell proliferation, migration, and invasion. PMID: 25124473
  39. FOXC1 assay (IHC & qRT-PCR) accurately identified basal-like breast cancer (BLBC) in FFPE samples. FOXC1 expression also predicted the development of brain metastasis. PMID: 26041837
  40. we showed that a novel long non-coding RNA FOXCUT and its neighboring gene FOXC1 may function as a lncRNA-mRNA gene pair, which may represent a potential prognostic biomarker and therapeutic target for esophageal squamous cell carcinoma patients PMID: 25031703
  41. Genome-wide association analysis linked the FOXC1-interacting transcription factor PITX2 to cerebral small-vessel disease. PMID: 25250569
  42. suggest that reduced expression of miR-639 underscores the mechanism of TGFbeta-induced epithelial-mesenchymal transition in tongue squamous cell carcinoma by targeting FOXC1 and may serve as therapeutic targets in the process of metastasis PMID: 25130698
  43. Dysfunction of the stress-responsive FOXC1 transcription factor contributes to trabecular meshwork cell death and the earlier-onset glaucoma observed in Axenfeld-Rieger syndrome patients. PMID: 24556684
  44. Data indicate that among 31 thymus development-related genes, PBX1 copy number gain and FOXC1 copy number loss were presented in 43.0% and 39.5% of the tumors, respectively. PMID: 23444221
  45. A novel c.317delA mutation in FOXC1 in a Korean family with Axenfeld-Rieger syndrome, is reported. PMID: 23687430
  46. The data suggest existence of a complex regulatory pathway in the trabecular meshwork part of which includes interactions between FOXC1, miR-204, MEIS2, and ITGbeta1. PMID: 23541832
  47. High FOXC1 expression is associated with pancreatic ductal adenocarcinoma. PMID: 23242609
  48. High expression of FOXC1 is associated with non-small cell lung cancer patients. PMID: 23264086
  49. FOXC1 deletions were observed in four cases of anterior segment dysgenesis and related conditions. PMID: 22569110
  50. overexpression of FoxC1 in hepatpcellular carcinoma is a strong indicator of more-aggressive tumors and poor clinical outcome. PMID: 22911555

Show More

Hide All

Involvement in disease
Axenfeld-Rieger syndrome 3 (RIEG3); Anterior segment dysgenesis 3 (ASGD3)
Subcellular Location
Nucleus.
Tissue Specificity
Expressed in keratinocytes of epidermis and hair follicle. Expressed strongly in microvascular invasion (MVI) formation, basal-like breast cancer (BLBC) and hepatocellular tumors. Expressed in breast cancers (at protein level). Expressed in hematopoietic
Database Links

HGNC: 3800

OMIM: 601090

KEGG: hsa:2296

STRING: 9606.ENSP00000370256

UniGene: Hs.348883

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*