Recombinant Human Fos-related antigen 1 (FOSL1)

Code CSB-EP008792HU
Abbreviation Recombinant Human FOSL1 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-271aa
Target Protein Sequence
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.3 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. High FOS-like antigen 1 (FOSL1) expression with mutant KRAS protein lung and pancreatic cancer patients showed the worst survival outcome. PMID: 28220783
  2. Our findings indicated that functional SNP rs1892901 in FOSL1 might affect the expression of FOSL1, and ultimately increase the risk of gastric cancer. PMID: 28169308
  3. Fra1 inhibited the protein levels of Bcl2, cMyc, Survivin, and BclxL. Fra1 overexpression in intestinal mucosal epithelial cells may restrain damage repair after intestinal mucosal injury in inflammatory bowel disease remittent period through weakening the protective effect of intestinal mucosa, thus increasing the risk of recurrence. PMID: 29257201
  4. High FRA1 expression is associated with Esophageal Squamous Cell Carcinoma. PMID: 27882471
  5. constitutive activation and non-regulation of Fra-1 by bicalutamide in PC-3 cells suggested that Fra-1, probably a key component, involved in transition of aggressive androgen-independent PC-3 cells with poor prognosis. PMID: 28386843
  6. the overexpression of Fra1 disrupted inflammatory cytokine secretion by medullary thymic epithelial cells in the myasthenia gravis thymus PMID: 29807388
  7. Taken together, our results indicated that miR-449 overexpression inhibited osteogenic differentiation of HG-FFA-treated hBMSCs through the Sirt1/Fra-1 signal pathway. PMID: 29305863
  8. These findings indicate that an aberrant Wnt/beta-catenin signalling leads to the epithelial-mesenchymal transition and drug resistance of glioma via Fra1 induction, which suggests novel therapeutic strategies for the malignant disease. PMID: 28232512
  9. MUC1 enhancement of ERK activation influences FRA-1 activity to modulate tumor migration, invasion and metastasis in a subset of pancreatic cancer cases PMID: 27220889
  10. the results indicate that FRA1 promotes cancer growth through AKT, and enhances cancer cell migration through JNK/c-Jun, pinpointing FRA1 as a key integrator of JNK and AKT signaling pathways and a potential therapeutic target for squamous cell carcinoma of the skin and head and neck squamous cell carcinoma. PMID: 27144339
  11. Study shows that FOSL1 is the main immediate early AP-1 member induced by melanoma oncogenes; found that FOSL1 is involved in melanoma cell migration as well as cell proliferation and anoikis-independent growth. PMID: 28481878
  12. a Fra-1-miR-134 axis drives a positive feedback loop that amplifies ERK/JNK signaling and reduces chemosensitivity in ovarian cancer cells. PMID: 27685628
  13. PKCtheta;-induced phosphorylations control the ability of Fra-1 to stimulate gene expression and breast cancer cell migration. PMID: 27816489
  14. Multivariate analysis identified Fra-1 as an independent prognostic factor. Fra-1 may be involved in the progress of hepatocellular carcinoma and could be a promising molecular candidate in the diagnosis and treatment of hepatocellular carcinoma. PMID: 28653890
  15. Up-regulation of Fra-1 appeared in retinal ganglion cells following light-induced retina damage. PMID: 27002720
  16. HGF-induced FRA1 activation is associated with the fibrosis-dependent development of Hepatocellular Carcinoma. PMID: 27134167
  17. Our results demonstrate that Fra-1 is an important determinant of the metastatic potential of human colon cancer cells, and that the Fra-1 classifier can be used as a prognostic predictor in colon cancer patients. PMID: 26646695
  18. Results suggest that Fra-1 is upregulated in lung cancer tissues and functions by affecting the P53 signaling pathway. PMID: 26549498
  19. SIRT1 expression correlated positively with Fra-1 expression, metastasis and overall survival in patients with colorectal cancer PMID: 26975631
  20. miR-195 can repress the migration and invasion of prostate cancer cells via regulating Fra-1 PMID: 26337460
  21. Results suggested that Fra-1 expression is low in cervical cancer tissues and promotes apoptosis of cervical cancer cells by p53 signaling pathway. PMID: 25651840
  22. High Fra-1 expression significantly correlates with shorter overall survival. PMID: 25666264
  23. Fra-1 induces critical changes in the expression of tgfb1 and Epithelial-to-mesenchymal transition transcription factors through direct binding to the tgfb1, zeb1 and zeb2 genomic regulatory regions. PMID: 25301070
  24. Fra1 promotes the growth of HaCaT cells in vitro by arresting the cell cycle and inhibiting cell apoptosis. PMID: 25175497
  25. Intense immunohistochemical staining of Fra-1 was observed at the tumor marginal area adjacent to inflammatory cells and in parallel with IL-6 secretion and STAT3 activation in colorectal cancer tissues. PMID: 25750173
  26. These results suggest that FOSL1 may be related to IgAN severity. PMID: 24652774
  27. FRA1 plays an important role in mediating cross talk between oncogenic RAS-ERK and TGFbeta signaling networks during tumor progression. PMID: 24658684
  28. CD44 dysregulated the activation of the Fra1 gene. The interaction of Fra-1 and CD44 may therefore be important in cervical carcinoma. PMID: 24604526
  29. we review the current knowledge of av and b3 transcriptional regulation in endothelial cells and discuss the role of FOSL1 in angiogenesis PMID: 24084233
  30. Data indicate that estrogen induced the expression of c-Jun, Fra-1, c-Fos, cyclin D1 and cyclin E1 while tamoxifen (TMX) decreased the expression. PMID: 23625206
  31. MicroRNA-34 suppresses breast cancer invasion and metastasis by directly targeting Fra-1. PMID: 23001043
  32. Fra-1 and c-Fos have roles in supporting growth of human malignant breast tumors by activating membrane biogenesis at the cytoplasm PMID: 23301044
  33. Identification of a pharmacologically tractable Fra-1/ADORA2B axis promoting breast cancer metastasis. PMID: 23483055
  34. Fra-1 mediates anti-fibrotic effects in the lung through the modulation of proinflammatory, profibrotic and fibrotic gene expression. PMID: 22911824
  35. PKCtheta signalling as an important regulator of Fra-1 accumulation in estrogen receptor positive breast cancer cells. PMID: 22286759
  36. study reports Fra-1 is highly expressed in the muscle-invasive form of bladder cancer and to a lesser extent in superficial bladder cancer; gene coding for AXL tyrosine kinase is directly upregulated by Fra-1 in bladder cancer and other cell lines; data demonstrate that AXL mediates the effect of Fra-1 on tumour cell motility but not on cell proliferation PMID: 21822309
  37. data suggest the involvement of an injury-induced Fra-1 transcription factor as a regulator of keratinocyte gene expression, which might act as an antagonistic player to restrict epithelial-driven angiogenic responses during normal skin flap integration. PMID: 21840727
  38. This study demonstrated ESCC patients positive for Fra-1 to be associated with poor prognosis. The findings also suggest that Fra-1 regulation may play an important role in the progression of ESCC. PMID: 22028113
  39. Fra-1 was induced by Epstein-Barr virus LMP2A and is essential for LMP2A-triggered MMP9 expression. PMID: 22514348
  40. A high frequency of Fra-1 in DCIS tumours may be associated with early events in breast carcinogenesis. Although Fra-1 expression correlated with features of a more aggressive phenotype in IDC, no relationship with overall survival was found. PMID: 21371080
  41. the molecular data suggest that the functional outcome of the 11q12 rearrangements is deregulated expression of FOSL1. PMID: 22411068
  42. Enhanced FOSL1 expression significantly correlated with high psoriasis area and severity index. High level of FOSL1 gene expression was proposed to be a marker of pathological process activity in psoriasis. PMID: 22235402
  43. Rhinovirus-induced MMP-9 expression is dependent on Fra-1, which is modulated by formoterol and dexamethasone. PMID: 22461694
  44. identified Fra-1 as a new target of miR-34a and demonstrated that miR-34a inhibits Fra-1 expression at both protein and messenger RNA levels; p53 indirectly regulates Fra-1 expression via a miR-34a-dependant manner in colon cancer cells PMID: 22198213
  45. Molecular characterization of the microRNA-138-Fos-like antigen 1 (FOSL1) regulatory module in squamous cell carcinoma. PMID: 21969367
  46. Fra-1 is an important mediator of interstitial lung disease following gefitinib treatment PMID: 21460858
  47. study shows that YAP could promote cell proliferation by activating transcription factor Fra-1 in oral squamous cell carcinoma. PMID: 21708480
  48. RT-PCR showed that FOSL1 from osteoblasts from Pfeiffer syndrome grown on PLPG acid plates were upregulated after 30 days. PMID: 21558934
  49. Two AP-1 components, c-Jun and Fra-1, were phosphorylated, and bound to the AP-1 binding site of the MMP-1 promoter in 143B cells. PMID: 21640141
  50. Activated nuclear factor kappaB and Fos-related antigen 1 are elevated in epithelial cells in lung tissues of patients with acute respiratory distress syndrome. PMID: 21526963

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
BZIP family, Fos subfamily
Database Links

HGNC: 13718

OMIM: 136515

KEGG: hsa:8061

STRING: 9606.ENSP00000310170

UniGene: Hs.283565

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*