Recombinant Human Gamma-aminobutyric acid receptor subunit alpha-2 (GABRA2), partial

Code CSB-EP009141HU
Abbreviation Recombinant Human GABRA2 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
GABA(A) receptor subunit alpha-2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
29-249aa
Target Protein Sequence
NIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.4 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand-gated chloride channel which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain. Plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel. The gamma2 subunit is necessary but not sufficient for a rapid formation of active synaptic contacts and the synaptogenic effect of this subunit is influenced by the type of alpha and beta subunits present in the receptor pentamer. The alpha2/beta2/gamma2 receptor exhibits synaptogenic activity whereas the alpha2/beta3/gamma2 receptor shows very little or no synaptogenic activity.
Gene References into Functions
  1. Findings suggest GABRA2 variation influences drug-seeking behavior through both alcohol-related and alcohol-independent pathways. PMID: 29528673
  2. rs505474, rs1398175, and rs4868029 in the GABRA2, GABRA4, and GABRP genes, respectively, allele frequencies were significantly different between patients and controls.Four haplotypes were significantly associated with Bipolar Disorder TA and AG for rs3815762 and rs4868029 in GABRP, GG for rs11636988 and rs8024256 in GABRB3 and GAGG for rs2197414, rs4921195, rs13188991, and rs11956731 in GABRA6. PMID: 29135068
  3. The results of the present study suggest that the GABRA2 genotype interacts with stress in young people with impact on the development of alcohol use and aggressive behaviour. PMID: 28237505
  4. GxE interaction: GABRA2 x Positive Peer Involvement on adolescent behavior. PMID: 27581089
  5. Association between GABRA2 and Alcohol Dependence was essentially limited to individuals with co-occurring Drug Dependence. The GABAA receptor is a heteropentamer so there are multiple potential variants in either GABRA2 or other receptor subunits which might associate with the phenotypes of interest and there is also a high degree of linkage disequilibrium across the region. PMID: 27575312
  6. GABA alpha2 and/or alpha3 receptor subtypes are involved in GABAergic modulation of prolactin secretion. PMID: 27128218
  7. An uncorrected exploratory analysis revealed associations between GABBR2, GABRA2 and DRD2 variants with transcranial magnetic stimulation measures of corticospinal excitability and cortical inhibition in Huntington's disease, as well as with age at onset. PMID: 27033668
  8. SNP rs279858 mediates alcohol drinking in alcohol dependent individuals PMID: 27117237
  9. The alpha2 gradually increased during development, showing some layer specificity in the cerebellar cortex. PMID: 26518133
  10. parental externalizing was associated with more life events, and the association between life events and subsequent adolescent externalizing varied as a function of GABRA2 genotype (p PMID: 26075969
  11. A GABRA2 x Parental Monitoring effect on externalizing behavior trajectory was observed, such that A-carriers were largely unaffected by parental monitoring, whereas trajectory for those with the GG genotype was affected by parental monitoring. PMID: 25797587
  12. GABRA2 SNPs directly predicted adolescent alcohol problems. PMID: 25804982
  13. Alcohol dependence-associated variation in GABRA2 is associated with differential expression of the entire cluster of GABAA subunit genes on chromosome 4p12 in neural stem cells. PMID: 26250693
  14. Recent drinking history (p = 0.01), and recent drinking history x genotype interaction (p = 0.01) were significantly associated with acute adaptation of the subjective responses to alcohol for the GABRA2 SNP rs279858. PMID: 26087834
  15. The results of this study support a growing body of evidence linking GABAA receptors with the development of alcohol tolerance, dependence and withdrawal symptoms PMID: 26116794
  16. GABRA2 is significantly associated with rule breaking in mid- to late adolescence, but not substance abuse symptomatology across adolescence. PMID: 24811113
  17. GABRA2 genetic variants play a role in antipsychotic-associated weight gain. PMID: 25514066
  18. The results suggest that SNP variation in the GABRA2 gene leads to higer risk of increased drunkenness in the period adolescence to you adulthood PMID: 23692184
  19. Results suggest that the genetic effect of GABRA2 on externalizing behavior, more specifically on rule breaking is, at least in part, due to its effect on susceptibility to environmental exposure (i.e., peer delinquency) PMID: 25365806
  20. This study demonstrates an impact of GABRA2 genotype on incentive-motivation neurocircuitry in adolescence, with implications for vulnerability to alcoholism. PMID: 24975023
  21. the current study failed to replicate previous associations between two well replicated GABRA2 single nucleotide polymorphisms and conduct disorder and CD and alcohol dependence PMID: 24687270
  22. The results support the involvement of the brain GABA receptor gene, GABRA2, in the pathogenesis of alcohol dependence. PMID: 24136292
  23. Two single nucleotide polymorphisms (SNPs) in GABRA2 are associated with altered stimulatory effects of alcohol. PMID: 24166645
  24. Wild-type and mutant mice have similar baseline nociceptive sensitivities and develop similar hyperalgesia specifically targeting alpha2-GABAA receptors which exert their antihyperalgesic effect through enhanced spinal nociceptive control. PMID: 24045508
  25. GABRA2 protein and mRNA levels were significantly increased in schizophrenia, major depressive disorder, and bipolar disorder patients' lateral cerebellum compared to controls. PMID: 24022508
  26. Upregulation of GABRA2 may indicate that GABA might play a role in the pathogenesis of pruritus in intrahepatic cholestasis of pregnancy PMID: 23480690
  27. GABRA2 variation in the region between introns 3 and 4 is associated with impulsiveness and this effect partially influences the development of alcohol problems. PMID: 23566244
  28. The current study examined the influence of gender, negative and positive daily life events, and GABRA2 genotype (SNP rs279871) on alcohol dependence PMID: 23974430
  29. Variation within GABRA2 is associated with attenuated negative responses to alcohol, a known risk factor for vulnerability to alcohol use disorders. PMID: 22501025
  30. We present a model of 2-AG docked to the GABA(A) receptor PMID: 23600744
  31. This study revealed a positive correlation, among women, between BMI and the GABRA2 genotype, previously associated with both conduct problems and substance dependence. PMID: 22882390
  32. The gene for the GABA-A receptor alpha-2 subunit, the G allele of the SNP rs11503014 was associated with high cocaine cue-reactivity. PMID: 22882391
  33. There is evidence that variants in the GABRA2 gene are associated with alcoholism. PMID: 22555154
  34. GABRA2 genotype, as well as the number of intake drug abuse problems and a younger age, were associated with an increased risk of relapse PMID: 22129841
  35. results suggest that GABRA2 genetic variation is associated with Impulsiveness through variation of insula activity responses. PMID: 21483437
  36. GABRA2 alleles affect the subjective responses to alcohol, and suggest that the genetic variations in GABRA2 might play a role in the risk of alcohol use disorders by moderating the subjective effects of alcohol. PMID: 21118274
  37. a highly significant difference was shown between alcohol dependence subjects and controls in the frequency of a single nucleotide polymorphisms GABRA2 haplotype PMID: 21919924
  38. In subjects with schizophrenia, mean GABA(A) alpha2 receptor subunit mRNA expression is 14% higher in layer 2 of the dorsolateral prefrontal cortex. PMID: 20843900
  39. An interaction between allelic variation in GABRA2 and BDNF genes was associated with GM volumes, suggesting that inherited variation in these genes may promote early developmental differences in neuronal proliferation of the cerebellum. PMID: 22047728
  40. no evidence for an association between GABRA2 polymorphisms and alcohol dependence. PMID: 21683760
  41. These are the first data to suggest that GABRA2 genotype could affect the brain's responses to cues associated with alcohol. PMID: 20698837
  42. conduct problems, and a conduct-problem-associated GABRA2 genotype, decrease the age-of-onset and/or increase the lifetime duration of obesity. PMID: 20716301
  43. No evidence of an association is found at the allele, genotype, haplotype, or diplotype levels between the alpha-2 subunit of GABA receptor single nucleotide polymorphisms and alcoholism in Italian controls. PMID: 20102561
  44. Study propose that the collybistin-gephyrin complex has an intimate role in the clustering of GABA(A)Rs containing the alpha2 subunit. PMID: 20622020
  45. No association between GABRA2 single nucleotide polymorphism and alcohol dependence in adolescents. PMID: 19783384
  46. In stroke case, the GABRA2 was down regulation in auditory cortex. PMID: 20048764
  47. found specific markers and haplotypes of the GABRA2 gene to be associated with cocaine addiction PMID: 20133874
  48. Together with childhood trauma, GABRA2 variation influences risk and resilience for all addiction but most strongly for heroin dependence. PMID: 19833324
  49. These findings suggest that common variation in the GABRA2, GABRA3, GABRA6, and GABRG2 genes does not play a major role in liability to anxiety spectrum disorders. PMID: 19842164
  50. GABRA2 might influence susceptibility to alcohol dependence by modulating the level of neural excitation PMID: 15024690

Show More

Hide All

Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane. Cell projection, dendrite.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRA2 sub-subfamily
Database Links

HGNC: 4076

OMIM: 103780

KEGG: hsa:2555

STRING: 9606.ENSP00000348897

UniGene: Hs.116250

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*