Recombinant Human Gastrotropin (FABP6)

Code CSB-EP007955HU
Abbreviation Recombinant Human FABP6 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Fabp6; FABP6_HUMAN; Fatty acid binding protein 6; ileal (gastrotropin) ; Fatty acid-binding protein 6; Gastrotropin; GT; I 15P; I BABP ; I BALB; I BAP; I-15P; I-BABP; I15P; IBABP ; IBALB; IBAP; ILBP; ILBP3 ; Ileal lipid binding protein; Ileal lipid-binding protein; ILLBP ; Intestinal 15 kDa protein; Intestinal bile acid binding protein; Intestinal bile acid-binding protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-128aa
Target Protein Sequence
MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.4kDa
Protein Length
Full Length of BC022489
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes. In vitro binds to bile acids in the order: deoxycholic acid > cholic acid > chenodeoxycholic acid and respective BA conjugation modifies affinities in the order taurine-conjugated > glycine-conjugated > unconjugated bile acids. Stimulates gastric acid and pepsinogen secretion.; Essential for the survival of colon cancer cells to bile acid-induced apoptosis.
Gene References into Functions
  1. Structural determinants of ligand binding in the ternary complex of human ileal bile acid binding protein with glycocholate and glycochenodeoxycholate obtained from solution NMR PMID: 26613247
  2. Analysis of slow and fast motions in I-BABP indicates largely different energy landscapes for the apo and holo states suggesting that optimization of binding interactions might be achieved by altering the dynamic behavior of specific protein segments. PMID: 25073073
  3. show, using electrospray ionization mass spectroscopy, that human ILBP binds bile acids with a 3:1 ratio, even at low protein and ligand concentrations PMID: 23758264
  4. Ursodeoxycholic acid induces unique conformational changes in IBABP. PMID: 22223860
  5. NMR data are in agreement with a conformational selection model we proposed earlier for I-BABP and support the hypothesis of an allosteric mechanism of ligand binding PMID: 22329738
  6. The-putative functional-Thr79Met substitution of FABP6 confers a protective effect on type 2 diabetes in obese individuals. PMID: 19744871
  7. NMR structure of human ileal lipid-binding protein-cholyltaurine complex and its comparison with homologous structures PMID: 12486725
  8. the I-BABP gene may be a novel target for PPAR in humans PMID: 15936983
  9. ASBT and ILBP protein were 48% and 67% lower in normal weight gallstone carriers than in controls (P < 0.05); similar differences were found for mRNA expression levels. PMID: 16237211
  10. The expression of FABP6 was higher in primary colorectal cancers and adenomas than in normal epithelium, but was dramatically decreased in lymph node metastases, suggesting that FABP6 may play an important role in early carcinogenesis. PMID: 16951225
  11. In keeping with its role in the enterohepatic circulation and ileal reabsorption of bile acids, the gene promoter contains consensus elements for CDX2 and FXR. More than one transcription start site has been identified. PMID: 14654244

Show More

Hide All

Subcellular Location
[Isoform 1]: Cytoplasm. Membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 2]: Cytoplasm.
Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Tissue Specificity
Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. Isoform 2 is xpressed in the gallbladder, duodenum, jejunum, ileum, cecum, ascending, transverse and descending colon, sigmoid colon and rectum. Isoform 2 is expressed in c
Database Links

HGNC: 3561

OMIM: 600422

KEGG: hsa:2172

STRING: 9606.ENSP00000377549

UniGene: Hs.519719

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*