Recombinant Human Gastrotropin(FABP6)

Code CSB-EP007955HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P51161
Relevance Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes. In vitro binds to bile acids in the order: deoxycholic acid > cholic acid > chenodeoxycholic acid and respective BA conjugation modifies affinities in the order taurine-conjugated > glycine-conjugated > unconjugated bile acids. Stimulates gastric acid and pepsinogen secretion
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Fatty acid-binding protein 6 Ileal lipid-binding protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Research Area Signal Transduction
Source E.coli
Gene Names FABP6
Protein Names Recommended name: Gastrotropin Short name= GTAlternative name(s): Fatty acid-binding protein 6 Ileal lipid-binding protein Short name= ILBP Intestinal 15 kDa protein Short name= I-15P Intestinal bile acid-binding protein
Expression Region 1-128aa
Tag Info N-terminal GST-tagged
Mol. Weight 41.4kDa
Protein Description Full Length of BC022489
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes (By similarity). In vitro binds to bile acids in the order
Subcellular Location Isoform 1: Cytoplasm, Membrane, Peripheral membrane protein, Cytoplasmic side, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm
Protein Families Calycin superfamily, Fatty-acid binding protein (FABP) family
Tissue Specificity Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. Isoform 2 is xpressed in the gallbladder, duodenum, jejunum, ileum, cecum, ascending, transverse and descending colon, sigmoid colon and rectum. Isoform 2 is expressed in c
Database Links

HGNC: 3561

OMIM: 600422

KEGG: hsa:2172

STRING: 9606.ENSP00000377549

UniGene: Hs.519719

Pathway PPAR signaling pathway

Related Products

FABP6 Antibodies

FABP6 Antibodies for Human

FABP6 Antibodies for Homo sapiens (Human)

FABP6 Proteins

FABP6 Proteins for Homo sapiens (Human)

FABP6 ELISA Kit

FABP6 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.