Recombinant Human Glutamate carboxypeptidase 2(FOLH1),partial

In Stock
Code CSB-RP117294h
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q04609
Relevance Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Isoform PSM-4 and isoform PSM-5 would appear to be physiologically irrelevant. Involved in prostate tumor progression.Also exhibits a dipeptidyl-peptidase IV type activity. In vitro, cleaves Gly-Pro-AMC.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP117294h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FOLH1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP117294h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FOLH1.
Storage Buffer Tris-based buffer,50% glycerol
Alias Cell growth-inhibiting gene 27 proteinFolate hydrolase 1Folylpoly-gamma-glutamate carboxypeptidase ;FGCPGlutamate carboxypeptidase II ;GCPIIMembrane glutamate carboxypeptidase ;mGCPN-acetylated-alpha-linked acidic dipeptidase I ;NAALADase IProstate-specific membrane antigen ;PSM ;PSMAPteroylpoly-gamma-glutamate carboxypeptidase
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Research Area Cancer
Protocol
Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.
Source E.coli
Gene Names FOLH1
Expression Region 48-750aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 83.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
References
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Involved in prostate tumor progression.; FUNCTION
Subcellular Location Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform PSMA': Cytoplasm
Protein Families Peptidase M28 family, M28B subfamily
Tissue Specificity Highly expressed in prostate epithelium. Detected in urinary bladder, kidney, testis, ovary, fallopian tube, breast, adrenal gland, liver, esophagus, stomach, small intestine, colon and brain (at protein level). Detected in the small intestine, brain, kid
Database Links

HGNC: 3788

OMIM: 600934

KEGG: hsa:2346

STRING: 9606.ENSP00000256999

UniGene: Hs.551896

Related Products

FOLH1 Antibodies

FOLH1 Antibodies for Human

FOLH1 Antibodies for Homo sapiens (Human)

FOLH1 Proteins

FOLH1 Proteins for Homo sapiens (Human)

FOLH1 ELISA Kit

FOLH1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.