Recombinant Human Glutamate carboxypeptidase 2(FOLH1),partial

In Stock
Code CSB-EP008782HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP117294h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FOLH1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP117294h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FOLH1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names FOLH1
Uniprot No. Q04609
Research Area Cancer
Alternative Names Cell growth inhibiting protein 27 ; Cell growth-inhibiting gene 27 protein; FGCP; Folate hydrolase (prostate-specific membrane antigen) 1; Folate hydrolase 1; Folate hydrolase; Folate hydrolase prostate specific membrane antigen 1; FOLH 1; FOLH; Folh1; FOLH1_HUMAN; Folylpoly gamma glutamate carboxypeptidase; Folylpoly-gamma-glutamate carboxypeptidase; GCP 2; GCP II; GCP2; GCPII; GIG27; Glutamate carboxylase II; Glutamate carboxypeptidase 2; Glutamate carboxypeptidase II; Membrane glutamate carboxypeptidase; mGCP; N acetylated alpha linked acidic dipeptidase 1; N-acetylated-alpha-linked acidic dipeptidase I; NAALAD 1; NAALAD1; NAALAdase; NAALADase I; Prostate specific membrane antigen; Prostate specific membrane antigen variant F; Prostate-specific membrane antigen; PSM; PSMA; Pteroylpoly gamma glutamate carboxypeptidase; Pteroylpoly-gamma-glutamate carboxypeptidase
Species Homo sapiens (Human)
Source E.coli
Expression Region 48-750aa
Target Protein Sequence EATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 83.1kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Citations

Parallel optical read-out of micromechanical pillars applied to prostate specific membrane antigen detection. Tardivo M. et al,Biosens Bioelectron,2015

Application: PSMA detection
Review: We performed the detection of a commercial PSMA recombinant protein, r-PSMA, produced in prokaryotic cells and therefore not glycosylated.
PMID: 26025134

Target Data

Function Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Involved in prostate tumor progression.; FUNCTION
Gene References into Functions
  1. PSMA, TERT, and PDEF may serve as a reference for clinical diagnosis and as potential targets for the malignant tumor of the prostate therapeutics PMID: 28829509
  2. Furthermore, the results also demonstrate that the stability of GCPII protein is regulated by HDAC1 through acetylation at the lysine 479 residue. PMID: 29448109
  3. Results provide evidence that PSMA is expressed in the neovasculature of a subset of soft tissue tumors to a variable extent predominantly occurring in sarcomas. PMID: 28002805
  4. PSMA is significantly overexpressed in the neovasculature of differentiated thyroid cancers compared with normal and benign thyroid nodules PMID: 28844117
  5. Demonstrate that several laminin-derived peptides containing carboxy-terminal glutamate moieties (LQE, IEE, LNE) are bona fide substrates for PSMA. Subsequently, the peptide products were tested for their effects on angiogenesis in various models. PMID: 27387982
  6. results demonstrate both the feasibility of preparing PSMA-targeted MBs and the benefits of using bioorthogonal chemistry to create targeted US probes PMID: 28472168
  7. Xenografted human tumors expressing different levels of prostate-specific membrane antigen (PSMA) was produced to assess the clearance, biodistribution and imaging potential of 123I-scFvD2B. PMID: 28051996
  8. GCPII may not be a priority target for molecular imaging of atherosclerotic lesions. PMID: 27609368
  9. We also confirmed the specificity and selectivity of prostate-specific membrane antigen targeting by assessing prostate-specific membrane antigen-null PC3 cell lines under the same conditions (<10% cell ablation PMID: 28351335
  10. In conclusion, we have successfully developed the specific PSMA-targeting IO nanoparticle, DOTA-IO-GUL, as a dual-modality probe for complementary PET/MR imaging PMID: 26739097
  11. The risk of coronary disease and ischemic stroke associated with multiple polymorphisms and haplotypes of MADD and FOLH1 in Han Chinese patients are reported in association with alcohol consumption. PMID: 27070640
  12. MDM2 and PSMA may co-regulate the expression of certain MMPs and, thus, the functionality of cells in metastatic breast cancer. PMID: 26977010
  13. Systemic treatment with these radiation-sensitizing agents selectively enhanced the potency of external beam radiation therapy for established PSMA-positive tumors. PMID: 26438155
  14. prostate-specific membrane antigen is significantly overexpressed in adrenocortical carcinoma neovasculature when compared with normal and benign adrenal tumors PMID: 26771706
  15. Data show that the expressed antibody could specifically bind to prostate-specific membrane antigen ( PSMA) positive cells. PMID: 27358992
  16. Ad5/35E1aPSESE4 is effective in marking PSA/PSMA-positive prostate cancer cells in patient blood to improve the efficacy of utilizing CTCs as a biomarker. PMID: 26723876
  17. evaluated the relaxometric properties of these agents in solution, in prostate cancer cells, and in an in vivo experimental model to demonstrate the feasibility of PSMA-based MR molecular imaging PMID: 26212031
  18. First evidence of PSMA expression in differentiated thyroid cancer using [Ga]PSMA-HBED-CC PET/CT. PMID: 25916744
  19. In vitro immunotherapy is described for anti-prostate cancer effects of cytotoxic T lymphocytes induction by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells. PMID: 26125931
  20. Results from genetic models highlight the importance of GCPII genetic variants as relatively novel risk factors for breast cancer and prostate cancer. PMID: 26471812
  21. The findings suggest that C1561T-GCPII variation may be associated with risk for adenomatous polyp, and vitamin C may modify risk by interacting with the variant gene, its expression product and/or folate substrates. PMID: 26028103
  22. This study demonstrates the feasibility of D2B IgG, F(ab')2 and Fab fragments for targeting PSMA-expressing prostate cancer xenografts. PMID: 24764162
  23. This study demonstrated that Overexpression and Nucleolar Localization gcp2 in glioblastoma. PMID: 26079448
  24. we focus on the susceptibilities of these PSA-PSMA prostate clones to factors that promote prostate hyperplastic, neoplastic and metastatic development PMID: 24788382
  25. PSMA expression may be correlated with nanog's expression as well as with other confounders in a population of prostate CSCs. PMID: 24762500
  26. High glutamate carboxypeptidase II levels are associated with pancreatic cancer. PMID: 24477651
  27. High tumor PSMA expression was not an independent predictor of lethal prostate cancer in the current study. PMID: 24130224
  28. Taken together, this study demonstrated that the increase in GCPII induced by VPA is not due to the classical epigenetic mechanism, but via enhanced acetylation of lysine residues in GCPII. PMID: 24939622
  29. our data may suggest a new role for PSMA in prostate cancer progression, and provide opportunities for developing non-invasive approaches for diagnosis or prognosis of prostate cancer PMID: 24424840
  30. Tumor-associated vasculature was PSMA-positive in 74% of primary breast cancers and in 100% of breast cancers metastatic to brain. PSMA was not detected in normal breast tissue. No significant association was seen between PSMA and lymph node involvement. PMID: 24304465
  31. the impact of Glutamate carboxypeptidase II (GCPII) haplotypes on the expression of PSMA, BNIP3, Ec-SOD, GSTP1 and RASSF1 genes were elucidated to understand the epigenetic basis of oxidative stress and prostate cancer risk. PMID: 23979608
  32. PSMA is part of a proteolytic cascade where it acts downstream of MMP-2 to create small pro-angiogenic laminin peptides. PMID: 23775497
  33. The increase in gene expression ratio of PSA:PSMA to about 4.95 strongly correlated with the prostate cancer and with high intratumoral angiogenesis. PMID: 24063616
  34. High glutamate carboxypeptidase II mRNA expression is associated with pelvic lymph node micrometastasis in prostate cancer. PMID: 24292502
  35. Data suggest the importance of an aromatic group and succinimide moiety for high affinity of probes with prostate-specific membrane antigen (PSMA) PMID: 24063417
  36. Taking into account the PC phenotypes according to RKIP among PSA-PSMA profiles may improve distinguishing them from cancers that will become more aggressive. PMID: 23991415
  37. Data suggest the radioimmunoscintigraphic detection of radiolabeled prostate specific membrane antigen (PSMA antibodies might not be entirely specific for prostatic cells PMID: 21640619
  38. Data indicate that PSA, PSMA, hK2, PSCA, DD3, and their combinations, combined analysis of PSA and/or hK2 expression in pelvic lymph nodes could predict biochemical recurrence free survival (BRFS) following radical prostatectomy (RP). PMID: 21600799
  39. These data suggest that GCPII has two distinctive binding sites for two different substrates and that ABETA degradation occurs through binding to S1 pocket of GCPII. PMID: 23891752
  40. Data indicate that glutamate carboxypeptidase II (GCPII) is not an amyloid peptide-degrading enzyme. PMID: 23525278
  41. Data did not show any amyloid-beta (Abeta) peptide degradation activity of glutamate carboxypeptidase II (GCPII). PMID: 23525279
  42. Folate plus vitamin B12 supplementation can improve negative symptoms of schizophrenia, but treatment response is influenced by FOLH1 genetic variation in folate absorption. PMID: 23467813
  43. PSMA could be used as an independent prognostic marker for the osteosarcoma patients PMID: 22009216
  44. Canine PSMA reveals similar characteristics to human PSMA rendering this protein useful as a translational model for investigations of prostate cancer as well as a suitable antigen for targeted therapy studies in dogs. PMID: 23359458
  45. androgen-deprivation induced a decrease in AR and PSMA levels in androgen-sensitive LNCaP cells, which may be associated with the development of more aggressive disease-state following androgen deprivation therapy. PMID: 23041906
  46. The D191V variant increases breast cancer risk by affecting plasma folate. V108A and P160S variants reduce breast cancer risk. V108A and G245S varients are associated with prostate cancer risk. PMID: 23266799
  47. To conclude, GCPII haplotypes influenced susceptibility to stroke by influencing homocysteine levels. PMID: 23259322
  48. The survivin promoter exhibited a higher transcriptional activity than PSMA promoter and enhancer in prostate tumor cell lines. PMID: 22568207
  49. High expression of prostate-specific membrane antigen in the tumor-associated neo-vasculature is associated with worse prog-nosis in squamous cell carcinoma of the oral cavity. PMID: 22460809
  50. The PSM-E splice variant of PSMA suppression effect on cell proliferation is stronger compared to PSMA and the suppression effect on invasiveness is weaker than that of PSMA. PMID: 22322627
  51. An overview of GCPII/PSMA in cancer, as well as a discussion of imaging and therapy of prostate cancer using a wide variety of PSMA-targeting agents is provided. [review] PMID: 22304713
  52. Statistically significant association was not observed between dietary folate levels and GCPII expression. PMID: 22310383
  53. Glutamate carboxypeptidase II gene combined AG GG rs202676 genotype was significantly associated with anencephaly, but not with spina bifida or encephalocele. Overall, the rs202676 A>G polymorphism is a potential risk factor for anencephaly. PMID: 22124883
  54. The FOLH1 1561C>T polymorphism may be associated with the risk of depressive symptoms. PMID: 21597034
  55. The finding of PSMA in the bladder cancer neovasculature suggests that this molecule may promote tumor growth and may represent a potential new vascular target in this disease. PMID: 21725290
  56. Prostate-specific membrane antigen is expressed in the vasculature of glioblastoma multiforme vessels, thus rendering a potential novel therapeutic vascular target. PMID: 22032578
  57. Data show that the full-length PSMA sequence containing all three epitopes was poorly immunogenic, but only those against PSMA(27) or PSMA(663) peptides, and not PSMA(711) , were able to kill tumor cells expressing endogenous PSMA. PMID: 21604260
  58. Results establish that relative changes in PSMA expression levels can be quantitatively measured and could serve as a biomarker of AR signaling to noninvasively evaluate AR activity in patients with CRPC. PMID: 21606347
  59. PSMA and PSA are regulated differentially and the difference in their expression showed a correlation with malignant transformation PMID: 21189143
  60. Data show that the selected virus preferentially infects PSMA-expressing cells through the targeting peptide and infects LNCaP tumors after intravenous injection. PMID: 20670952
  61. important physiological role for GCPII in Abeta clearance in brain and provide the evidence that dysregulation of GCPII is involved in Alzheimer's disease pathology PMID: 20624932
  62. These results suggest that a specific antitumor immune response is enhanced by DNA vaccines expressing PSMA PMID: 20452657
  63. parental C1561T polymorphism associated with increased risk for neural tube defects PMID: 20047525
  64. expressed in prostate tissue, and especially in prostate cancer tissue PMID: 12474535
  65. GCP2 polymorphism explained nearly 50% of the variance of red blood cell folate in ESRD PMID: 12707400
  66. GCP2 1561C>T is associated with elevated folate levels but not homocysteine levels in kidney transplant patients PMID: 12753319
  67. PSMA expression is regulated by NFATc1 with an AP-3 binding site PMID: 12850144
  68. N-linked carbohydrate structures are important for the folate hydrolase function of the protein. Removal of sugars partially or completely causes PSMA to be enzymatically inactive, improperly folded, resulting in increased rate of degradation. PMID: 12949938
  69. PSMA is internalized via a clathrin-dependent endocytic mechanism and that internalization of PSMA is mediated by the five N-terminal amino acids PMID: 14528023
  70. proteins binding PSMA PMID: 15141017
  71. Analysis of the predicted N-glycosylation sites also provides evidence that these sites are critical for GCPII carboxypeptidase activity PMID: 15152093
  72. amino acid segments at the N- and C-termini of the ectodomain of GCPII are essential for its carboxypeptidase activity and/or proper folding PMID: 15206943
  73. PSMA gene lacks specificity for detecting prostate epithelial cells PMID: 15389976
  74. Knockdown of PSMA expression increased invasiveness of LNCaP cells by 5-fold. PMID: 15705868
  75. Transcriptional activity of the PSMA promoter/enhancer is prostate specific. PMID: 15713827
  76. Structure and relevance to the development of chemotherapeutics and cancer-imaging agents. PMID: 15837926
  77. PSMA may function as a receptor internalizing a putative ligand, an enzyme playing a role in nutrient uptake, and a peptidase involved in signal transduction in prostate epithelial cells. [review] PMID: 15840561
  78. acquisition of folding determinants in the Golgi is an essential prerequisite for protein trafficking and sorting of PSMA PMID: 16221666
  79. The folate hydrolase activity of PSMA may provide a growth advantage to prostate cancer cells in low folate and physiological folate environments. PMID: 16496414
  80. PSMA binds to caveolin-1 and undergoes internalization via a caveolae-dependent mechanism in microvascular endothelial cells PMID: 16713605
  81. In suicide gene therapy, anti-PSMA-liposome complex exerted a significant inhibitory effect on the growth of LNCaP xenograft, in contrast to normal IgG-liposome complex. PMID: 17032155
  82. Using pure recombinant GCPII and homologous GCPIII, we conclude that GCPII is responsible for the majority of overall NAAG-hydrolyzing activity in the human brain. PMID: 17150306
  83. Polymorphism is associated with higher plasma folate and lower homocysteine concentrations in women who abstain from alcohol. PMID: 17684227
  84. Pattern differences in GCP II gene promoter expression in SVG and LNCaP cells suggest that sequences beyond 240 bp may be important for tissue-specific GCP II expression. PMID: 17689503
  85. the residues forming the S1 pocket might be more important for the 'fine-tuning' of GCPII substrate specificity PMID: 17714508
  86. the intracellular transport of PSMA occurs through populations of DRMs distinct for each biosynthetic form and cellular compartment PMID: 17935484
  87. Tissues such as prostate and testes exhibit different GCPII expression levels among the species studied (human, rats, swine). PMID: 18076021
  88. Crystal structures of human GCPII in complex with phosphapeptide analogs show the S1 pocket of GCPII and the data indicate the importance of Asn519, Arg463, Arg534, and Arg536 for recognition of the penultimate (i.e., P1) substrate residues. PMID: 18234225
  89. prostate-specific membrane antigen is expressed in tumor-associated neovasculature of the majority of renal cortical tumors PMID: 18344976
  90. PSMA is underexpressed in advanced stage endometrial adenocarcinoma (EAC); loss of PSMA expression can be considered as a prognostic marker in patients with EAC; loss of PSMA expression in a subset of EAC cases could be due to epigenetic silencing PMID: 18349274
  91. Given our finding of frequent expression of PSMA in Schwannomas, they should be clinically considered in the differential diagnosis of a lesion that is positive on PSMA radioimmunoscintigraphy study performed during a metastatic work-up of PCa patient. PMID: 18534872
  92. the efficacy of 5-FU-based chemotherapy in prostate cancers can be significantly improved by targeted expression of the suicide gene UPRT under the control of prostate-specific membrane antigen promoter/enhancer PMID: 18626508
  93. The present study describes an efficient RNAi system for gene silencing that is specific to prostate cancer cells using the PSMA promoter/enhancer PMID: 18639471
  94. Neonatal methylmalonic acid was predicted by maternal methylmalonic acid and GCPII PMID: 18823966
  95. prostate-specific membrane antigen is expressed in neovasculature from physiologic regenerative and reparative conditions PMID: 18839017
  96. PSMA was the most useful marker to identify residual prostatic carcinoma after hormone therapy. PMID: 18844933
  97. Ectopic PSMA expression on PC-3 cells increased the invasive capacity of cells in in vitro invasion assays, which could be competed out by folic acid. These results suggest PSMA facilitates the development of prostate cancer PMID: 18974153
  98. analysis of interactions between human glutamate carboxypeptidase II and urea-based inhibitors PMID: 19053759
  99. PSM' protein is likely not generated by alternative splicing of the PSMA gene but by different mechanism, probably via an endoproteolytic cleavage of the full-length PSMA. PMID: 19107881
  100. although the RFC1 80G > A and FOLH1 1561C > T polymorphisms may influence folate status, they are not likely to have a major independent role in the development of colorectal cancer PMID: 19172696

Show More

Hide All

Subcellular Location Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform PSMA': Cytoplasm
Protein Families Peptidase M28 family, M28B subfamily
Tissue Specificity Highly expressed in prostate epithelium. Detected in urinary bladder, kidney, testis, ovary, fallopian tube, breast, adrenal gland, liver, esophagus, stomach, small intestine, colon and brain (at protein level). Detected in the small intestine, brain, kid
Database Links

HGNC: 3788

OMIM: 600934

KEGG: hsa:2346

STRING: 9606.ENSP00000256999

UniGene: Hs.551896

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1