Recombinant Human Glutathione peroxidase 3 (GPX3)(U73C)

In Stock
Code CSB-MP009868HU(M)
Abbreviation Recombinant Human GPX3 protein (U73C)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
GPx-3;GSHPx-3;Extracellular glutathione peroxidase;Plasma glutathione peroxidase;GPx-P;GSHPx-P
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
21-226aa(U73C)
Target Protein Sequence
QSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYCGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.
Gene References into Functions
  1. GPX3 rs736775 TC/CC were associated with intestinal type of gastric adenocarcinoma and was associated with improved Overall survival. PMID: 30114685
  2. the antioxidant enzyme GPX3 localizes to lung extracellular matrix and is variably upregulated in interstitial lung diseases. PMID: 27435875
  3. An association of the GPX3-TNIP1 locus with ALS is identified using cross-ethnic meta-analyses. [Meta-Analysis] PMID: 28931804
  4. Study provides evidence that GPX3 methylation in bone marrow is associated with adverse prognosis and leukemia transformation in myelodysplastic syndrome. PMID: 27891827
  5. this paper shows that GPx3 expression can be regulated independently via epigenetic or glucocorticoid receptor-mediated mechanisms in lung cancer cells PMID: 27484907
  6. negative expression of GPX3 was related to poor prognosis in melanoma patients. These results suggest that methylation-mediated GPX3 repression may have critical implications for melanoma pathogenesis PMID: 27600457
  7. The detection of the demethylated allele could be time and phe concentration dependent. The demethylated allele is suggested as an early epigenetic marker for an extracellular monitoring of an increased ROS production in newborns with PKU. PMID: 27742442
  8. A three-way interaction among maternal and fetal variants in BHMT2, GSTP1 and GPX3 contribute to congenital heart defects PMID: 26612412
  9. GPX3 hypermethylation is frequent in chronic myeloid leukemia and is negatively associated with its expression. PMID: 26261521
  10. Reduced GPX3 expression is associated with favorable/intermediate karyotypes but not with survival in de novo acute myeloid leukemia patients. PMID: 26045745
  11. GPX3 is frequently methylated in human papillary thyroid cancer and the expression of GPX3 was regulated by promoter region methylation PMID: 25929866
  12. Our results suggest that promoter methylation may be a mechanism for inactivation of GPX3, possibly leading to subsequent carcinogenesis and progression of HCC PMID: 25445749
  13. The T allele of -861A/T in GPX3 gene is a risk allele for the ischemic stroke phenotype. PMID: 25126700
  14. GPx3 is a tumor suppressor gene in HCC. PMID: 25333265
  15. GPx3 may have a possible role in modulating prostate carcinogenesis. PMID: 21374652
  16. Our results indicate that promoter methylation is one of the major causes of GPX3 downregulation in cervical cancer and GPX3 could serve as a predictive biomarker for lymph node metastasis and prognosis of cervical cancer. PMID: 24788695
  17. Myomectomy increases endometrial GPX3 expression after 3 months in women with myoma and infertility. PMID: 24518545
  18. Serum levels of GPx3 are increased in subjects with metabolic syndrome and that rs8177409 SNP was associated with cardiovascular risk in a Mexican population. PMID: 24819036
  19. RUNX2 and GPX3 are candidate genetic markers in the monitoring of embryo quality for PCOS patients. PMID: 24279306
  20. APOA1 and GPX3 mRNA levels on qRT-PCR effectively differentiate ovarian from breast carcinoma. PMID: 24926085
  21. Exposure to follicular fluid transiently increased the transcript levels of IL8 and PTGS2, and decreased the expression of SOD2, GPX3, DAB2, and NR3C1. TNF and IL6 levels were also decreased while those of NAMPT were unaffected. PMID: 24186266
  22. The Gpx3 protein levels were lower in the sera of the patients with amyotrophic lateral sclerosis than in other diseases. PMID: 23436019
  23. Knockdown of Gpx3 using short interfering RNA induced elevation in reactive oxygen species and cell death. PMID: 23132926
  24. determination of GPx3 levels in overweight and obese subjects from central Mexico PMID: 22981671
  25. dysfunction of GPX3 in gastric cancer is mediated by genetic and epigenetic alterations, suggesting impairment of mechanisms that regulate ROS and its possible involvement in gastric tumorigenesis and metastasis PMID: 23071548
  26. GPX3 overexpression was found in clear cell type ovarian adenocarcinoma compared with normal ovary and 3 other subtypes of epithelial ovarian cancer at mRNA level. PMID: 20730571
  27. In human primary acute myeloid leukemia samples, GPX3 expression level directly correlated with adverse prognostic outcome and positively correlated with the frequency of leukemia stem cells (LSCs). PMID: 22508837
  28. a novel signaling pathway of GPx3-PIG3 in the regulation of cell death in prostate cancer. PMID: 22461624
  29. The polymorphism of rs3828599 of GPx-3 gene might be associated with hypertension in rural Han Chinese from Fuxin, Liaoning. PMID: 21933611
  30. GPx3 methylation may have implications in chemotherapy response and clinical outcome of head and neck cancer patients PMID: 21684681
  31. Genetic variants of GPX3 are risk factors for arterial stroke, but not for thromboembolic arterial ischemic stroke or cerebral sinovenous thrombosis in children. PMID: 20946167
  32. GPX3 protein expression was significantly lower in esophageal squamous cell carcinoma than in adjacent nontumor tissues. In esophageal squamous cell carcinoma, GPX3 was downregulated through promoter hypermethylation. PMID: 20725785
  33. The intronic SNPs at GPX3 can influence gene expression leading to an alteration of gastric cancer risk. PMID: 20576521
  34. upregulated in vascular endothelial cells by proteasome inhibitors PMID: 19766714
  35. down-regulated KLF4, CHGA,GPX3, SST and LIPF, together with up-regulated SERPINH1, THY1 and INHBA is an 8-gene signature for gastric cancer PMID: 20043075
  36. REVIEW: The role of low levels of the serum glutathione-dependent peroxidase and glutathione and high levels of serum homocysteine in the development of cardiovascular disease. PMID: 11934214
  37. Increased erythrocyte glutathione peroxidase activity and serum TNFalpha in HIV-infected patients is related to pathogenesis of HIV infection and the hypercoagulable condition during HIV infection. PMID: 11983108
  38. in healthy subjects the seminal plasma activity is about 10 times greater than in infertile males PMID: 12553559
  39. a pilot study by analyzing 8 exudative ARMD patients for allelic variations in the GPX gene and three statistically significant mutations in the ABCR gene (R943Q, G1961E and D2177N) PMID: 15375613
  40. The high frequency of promoter hypermethylation and progressive loss of GPx3 expression in Barrett's adenocarcinomas suggest that epigenetic inactivation may be critical in the development and progression of Barrett's esophagus. PMID: 16229808
  41. There was no correlation between plasma GSH-Px and hair Se levels in the patient and control groups. These results revealed a decreased hair Se level and impaired antioxidative capacity in children with CRI on CAPD and HD PMID: 16937131
  42. A novel GPx-3 promoter haplotype is an independent risk factor for AIS in children and young adults. This haplotype reduces the gene's transcriptional activity, thereby compromising gene expression and plasma antioxidant and antithrombotic activities. PMID: 17122425
  43. GPx3 is a novel tumor suppressor gene. PMID: 17804715
  44. GPx3 mRNA was exclusively localized to the thyrocytes, showed the highest expression levels and was down-regulated in 5 of 6 thyroid cancer samples as compared to matched normal controls PMID: 17937619
  45. novel GPx-3 promoter haplotype is a strong, independent risk factor for cerebral venous thrombosis PMID: 18096833
  46. No significant risk for GPX3 in colorectal adenoma. PMID: 18483336
  47. The antioxidant effect of PPARgamma is exclusively mediated by GPx3 and further imply that GPx3 may be a therapeutic target for insulin resistance and diabetes mellitus. PMID: 18936159
  48. GPX3 may be a candidate gene associated with the low cisplatin sensitivity of clear cell adenocarcinoma PMID: 19020706
  49. G allele of rs3805435 or the T allele of rs3828599 of GPX3 may exert a protective effect, whereas the C allele of rs8177412 confers an increased risk effect for DTC PMID: 19375609

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Glutathione peroxidase family
Tissue Specificity
Secreted in plasma.
Database Links

HGNC: 4555

OMIM: 138321

KEGG: hsa:2878

STRING: 9606.ENSP00000373477

UniGene: Hs.386793

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*