Recombinant Human Golgi membrane protein 1 (GOLM1), partial

In Stock
Code CSB-EP009666HUe0
Abbreviation Recombinant Human GOLM1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
bA379P1.3; C9orf155; Chromosome 9 open reading frame 155; Golgi membrane protein 1; Golgi membrane protein GP73; Golgi phosphoprotein 2; Golgi protein 73 kD ; Golgi protein 73kD ; GOLM 1; GOLM1; GOLM1_HUMAN; GOLPH 2; GOLPH2; GP 73; GP73; PSEC0257
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
36-401aa
Target Protein Sequence
SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
68.6kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Unknown. Cellular response protein to viral infection.
Gene References into Functions
  1. GOLM1 acts as a critical oncogene by promoting prostate cancer cell proliferation, migration and invasion, and inhibiting apoptosis. GOLM1 plays oncogenic functions mainly through activating PI3K-AKT-mTOR signaling pathway. PMID: 29181846
  2. Results showed that GOLM1 was significantly upregulated in both LUAD and LUSC tissues compared to the normal controls. However, GOLM1 expression was higher in LUAD tissues than in LUSC tissues. PMID: 29843532
  3. GOLM1 was highly expressed in lung adenocarcinoma cells and associated with low survival ratio and higher grade malignancy; overexpression of GOLM1 promoted the cell proliferation. PMID: 29710483
  4. PDGFA/PDGFRalpha-regulated GOLM1 promotes glioma progression possibly through activation of a key signaling kinase, AKT PMID: 29282077
  5. GP73 is an effective and reliable serological marker for the diagnosis of advanced fibrosis and prediction of appearance of cirrhosis PMID: 29256057
  6. GOLPH2 promotes the progression of pancreatic ductal adenocarcinoma. PMID: 29344673
  7. serum GP73 is an accurate serum marker for significant fibrosis in chronic HBV infection, with higher accuracy than APRI and FIB-4. Serum GP73 is potentially a complementary tool for TE when evaluating the necessity of antiviral treatment, particularly in patients without definite antiviral indication. PMID: 29082644
  8. The detection of ALT, AFP, AFP-L3, and GP73 has a certain guiding significance to predict the risk of hepatocellular carcinoma in hepatic cirrhosis patients PMID: 28540298
  9. The mechanism of hepatocarcinogenesis and a promising blueprint for miR-493-5p-GP73 axis-oriented treatment of HCC. PMID: 28419971
  10. GP73 unglycosylation is associated with hepatocellular carcinoma cell motility and invasiveness. PMID: 26993603
  11. The GOLPH2 is a novel marker for non-small-cell lung cancer. PMID: 28880107
  12. Findings suggest that GP73 silencing through siRNA delivery may provide a low-toxicity therapy for the inhibition of tumor proliferation and metastasis. PMID: 26870893
  13. Both gain- and loss-of-function studies determine that GOLM1 acts as a key oncogene by promoting HCC growth and metastasis. PMID: 27569582
  14. A cytokine QTL at the NAA35-GOLM1 locus markedly modulated interleukin (IL)-6 production in response to multiple pathogens and was associated with susceptibility to candidemia. PMID: 27376574
  15. knock-down of GP73 down-regulates HCV infection and replication in Huh7-MAVSR cells and primary human hepatocytes PMID: 28394926
  16. Studies indicate that golgi membrane protein 1 (GOLM1) may promote HCC by regulation of epidermal growth factor receptor (EGFR) recycling, and suggest that therapeutic targeting of GOLM1 may be a potential strategy for combating hepatocellular carcinoma (HCC) metastasis. PMID: 27858335
  17. these studies revealed that GP73 promotes hepatitis C virus (HCV) secretion by directly mediating the interaction of ApoE with HCV replication complex through binding with HCV NS5A. PMID: 27697522
  18. Significantly higher serum levels of GP-73 and PIVKA-II were detected in the hepatocellular carcinoma patients than in controls. PMID: 28276727
  19. The critical role of GP73 in hepatocellular carcinoma invasion, epithelial-mesenchymal transition and metastasis PMID: 28075476
  20. Results show that overexpression of GP73 in hepatocellular carcinoma cell (HCC) line retrieved the expression of epithelial-mesenchymal transition (EMT) markers, and promoted cell motility and invasion. High expression of GP73 was also found in HCC tissues with metastasis providing evidence for an important role of GP73 in HCC metastasis. PMID: 26820712
  21. Serum GP73 had limited diagnostic value for HBV-related liver cancer. The combined use of serum GP73 and AFP levels improved the diagnostic efficacy. PMID: 26617863
  22. GP73 enhances MMP-13 expression through cAMP responsive element binding protein (CREB)-mediated transcription activation. Levels of GP73 and MMP-13 are increased and positively correlated in human HCC tissues. Augmented MMP-13 potentiates HCC cell metastasis. PMID: 26378022
  23. the specific antibody could block the binding of A10-2 to GP73, and the specific binding of A10-2 to GP73 was also supported by the observation that several tumor cell lines exhibited variable expression level of GP73. PMID: 26583119
  24. Transcatheter arterial chemoembolization significantly increased GP73 expression in patients with hepatocellular carcinoma. PMID: 26256086
  25. GP73 and AFP-L3 are superior biomarkers to aid the diagnosis of small PHC with negative AFP. The combined detection of biomarkers improved the diagnostic accuracy. PMID: 26406957
  26. The results of this meta-analysis showed that serum GP73 + AFP exhibited significantly higher diagnostic accuracy for HCC than did serum GP73 or AFP alone. PMID: 26441340
  27. Sublingual vein parameters and AFP, AFP-L3, and GP73 serum gene expression facilitate early diagnosis of patients with hepatocellular carcinoma. PMID: 26125916
  28. GOLPH2 may be a useful tissue biomarker for oesophageal disease. PMID: 26461057
  29. a GP73 assay is not suitable for discriminating between primary malignant and benign tumors of the liver. PMID: 25033446
  30. Increased expression of GP73 promotes proliferation and migration of hepatocellular carcinoma cell lines and growth of xenograft tumors in mice. PMID: 25980751
  31. Results show that GOLPH2 is upregulated in Gastric cancer and correlated with shorter overall survival suggesting that GLPH2 is associated with the development and progression of the disease. PMID: 25119897
  32. serum GP73 was found to be correlated with liver pathological grading and staging in patients with CHB, and may be an effective indicator for the evaluation of disease progression. PMID: 25524053
  33. GP73 may play an important role in the inhibitory regulation of autophagy. PMID: 25527157
  34. GOLM1 was directly regulated by miR-27b in prostate cancer cells PMID: 25115396
  35. The variation trend of gp73 in chronic liver disease may indicate that monitoring of serum gp73 is helpful to diagnose cirrhosis in population with chronic HBV infection. PMID: 25168922
  36. GP73 might play an important role in proliferation and apoptosis in hepatocellular carcinoma cells. PMID: 25170213
  37. Studied the serum levels of GP73 in patients with HBV-ACLF. Found concentrations of GP73 in patients with HBV-ACLF (285.3 +/- 128.5 ng/mL) were markedly higher than HCC patients (159.1 +/- 105.8 ng/mL),CHB patients (64.65 +/- 44.99 ng/mL),and healthy controls. PMID: 24560809
  38. The expression levels of GOLPH2 and IL-12A were negatively correlated. PMID: 24289573
  39. The results demonstrate the critical function of GP73 in HCV secretion and provide new insights into the therapeutic design of antiviral strategies. PMID: 24608522
  40. Data demonstrate that chimera GOLM1-MAK10 encodes a secreted fusion protein. Mechanistic studies reveal that GOLM1-MAK10 is likely derived from transcription read-through/splicing rather than being generated from a fusion gene. PMID: 24243830
  41. Overexpression of GOLM1 is associated with hepatocellular carcinoma. PMID: 23838921
  42. Loss of the tumor-suppressive miR-143/145 cluster enhanced cancer cell migration and invasion in PCa through directly regulating GOLM1. PMID: 24284362
  43. GP73 is involved in the regulation of epithelial-mesenchymal transformation and invasiveness of hepatocellular carcinoma. PMID: 24313979
  44. The usefulness of serum Transforming growth factor-beta1 (TGF-beta1), Glypican-3 (GPC3), and Golgi protein-73 (GP73) mRNAs as early biomarkers in HCC Egyptian patients, was investigated. PMID: 24186850
  45. GP73 is a potential marker for evaluating AIDS progression and antiretroviral therapy efficacy. PMID: 24068434
  46. Serum GP73 has a relatively high diagnostic accuracy in primary hepatic carcinoma with better sensitivity and high-specificity than alpha-fetoprotein.[review] PMID: 24779292
  47. Serum GP73 were increased in patients with fatty liver disease. PMID: 24579464
  48. GP73 is down-regulated in gastric cancer and associated with tumor differentiation. PMID: 23742050
  49. GP73 may be a marker for diagnosing significant fibrosis in patients with chronic HBV infections, and may be a new contributor to fibrogensis. PMID: 23418424
  50. GP73 content of liver cancer patients was significantly higher than the chronic hepatitis, cirrhosis patients and controls. PMID: 23627036

Show More

Hide All

Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Single-pass type II membrane protein. Note=Early Golgi. Cycles via the cell surface and endosomes upon lumenal pH disruption.
Protein Families
GOLM1/CASC4 family
Tissue Specificity
Widely expressed. Highly expressed in colon, prostate, trachea and stomach. Expressed at lower level in testis, muscle, lymphoid tissues, white blood cells and spleen. Predominantly expressed by cells of the epithelial lineage. Expressed at low level in n
Database Links

HGNC: 15451

OMIM: 606804

KEGG: hsa:51280

STRING: 9606.ENSP00000373363

UniGene: Hs.494337

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*