Recombinant Human Golgi phosphoprotein 3 (GOLPH3)

In Stock
Code CSB-EP872494HU
Abbreviation Recombinant Human GOLPH3 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
GOLPH3
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Coat protein GPP34 (Mitochondrial DNA absence factor) (MIDAS)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-298aa
Target Protein Sequence
MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.8 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

In the production of the recombinant Human GOLPH3 protein in e.coli cells, a sequential pipeline involves constructing the expression vector coding for the Human GOLPH3 protein (1-298aa), transforming the recombinant vector into e.coli cells, selecting the positive cells and cultivating them, lysing cells, and characterizing the protein. The resulting recombinant Human GOLPH3 protein is purified from the cell lysate using affinity purification. Its purity exceeds 85%, as determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Phosphatidylinositol-4-phosphate-binding protein that links Golgi membranes to the cytoskeleton and may participate in the tensile force required for vesicle budding from the Golgi. Thereby, may play a role in Golgi membrane trafficking and could indirectly give its flattened shape to the Golgi apparatus. May also bind to the coatomer to regulate Golgi membrane trafficking. May play a role in anterograde transport from the Golgi to the plasma membrane and regulate secretion. Has also been involved in the control of the localization of Golgi enzymes through interaction with their cytoplasmic part. May play an indirect role in cell migration. Has also been involved in the modulation of mTOR signaling. May also be involved in the regulation of mitochondrial lipids biosynthesis.
Gene References into Functions
  1. Overexpression of GOLPH3 may be involved in the resistance of HT29 colon cancer cells to cisplatin chemotherapy by activating multiple cell signaling pathways. PMID: 30015866
  2. High GOLPH3 expression is associated with breast cancer. PMID: 29534690
  3. This study provides a brand new evidence that GOLPH3 promotes glioma cell proliferation by facilitating Wls recycling and Wnt/beta-catenin signaling. PMID: 29990993
  4. High GOLPH3 expression is associated with glioma progression. PMID: 28575494
  5. Proteomic-based screens identified GOLPH3 as a resident protein of the Golgi apparatus, and second as an oncogene product in a screen for genes amplified in cancer. A third screen uncovered the association of GOLPH3 with the Golgi resident phosphatidyl inositol 4 phosphate to maintain the characteristic ribbon structure of the Golgi apparatus favoring vesicular transport of secretory proteins. [review] PMID: 28954815
  6. Overexpression of GOLPH3 resulted in the downregulation of p21 protein, upregulation of cyclin D1 and increased retinoblastomaassociated protein phosphorylation, consequently leading to accelerated cell cycle progression. PMID: 28901498
  7. Results indicate that GOLPH3 is an independent predictive factor for neoadjuvant chemoradiotherapy (nCRT) sensitivity and prognosis in locally advanced rectal cancer (LARC). PMID: 27634904
  8. Results provide evidences that overexpression of GOLPH3 stimulates EMT via the Wnt/beta-catenin signaling pathway, which further promotes metastasis of epithelial ovarian cancer. PMID: 28332316
  9. GOLPH3 levels may be a novel prognostic biomarker of tobacco related lung disease. PMID: 27611309
  10. Authors confirm that the decrease of GOLPH3 that promotes the apoptosis of glioma cells may be regulated by the activation of NDRG1 and cleaved capcase 3. There was a inverse association between GOLPH3 and NDRG1 in glioma samples. PMID: 27698340
  11. Data found that miR-134 was highly downregulated in gastric cancer tissues and cell lines and inversely correlated with GOLPH3. These results suggest that miR-134 regulates gastric cancer cell proliferation, at least potentially, through downregulation of the GOLPH3 gene, implicating a candidate tumor-suppressor miRNA in the pathogenesis of gastric cancer. PMID: 28260021
  12. In this review, we will explore the cellular functions regulated by GOLPH3 and discuss if and how they contribute to the oncogenic activity of this intriguing Golgi localized oncoprotein. PMID: 27378035
  13. cumulative evidence indicates that GOLPH3 participates in several cellular processes critical for cancer cells, emerging as an attractive therapeutic target PMID: 27123979
  14. GOLPH3 overexpression may participate in the occurrence and development of colorectal carcinoma by inhibiting apoptosis and promoting angiogenesis. PMID: 26730158
  15. Results show that high GOLPH3 and nuclear/cytoplasmic YB-1 expression correlated with a poor prognosis in patients with prostate cancer. PMID: 26794392
  16. Review/Meta-analysis: overexpression of GOLPH3 predicts poor prognosis in solid tumors. PMID: 26617771
  17. GOLPH3 is likely to play important roles in bladder cancer progression via modulating AKT/mTOR signaling, and it is a novel prognostic biomarker and promising therapeutic target for bladder cancer. PMID: 26375441
  18. GOLPH3 was expressed in prostate cancer cell lines. Our findings suggest GOLPH3 regulate MMP9 expression which impact cell migration and invasion. PMID: 26097550
  19. GOLPH3 promotes glioblastoma cell migration and invasion via the mTOR-YB1pathway. PMID: 25156912
  20. GOLPH3 expression predicts poor prognosis in patients with prostate cancer undergoing radical prostatectomy. PMID: 25760033
  21. High GOLPH3 expression is associated with poor prognosis and invasion of hepatocellular carcinoma PMID: 25634514
  22. The expression level of GOLPH3 is correlated with metastasis and prognosis in NSCLC, and GOLPH3 mediates metastasis by regulating the protein levels of MMP-2 and MMP-9 in vitro. PMID: 25659977
  23. Results show that in esophageal squamous cell carcinoma (ESCC), miR-126 was downregulated and IRS-1 and GOLPH3, overexpressed suggesting a tumor suppression role of miR-126 via the regulation of IRS-1 and GOLPH3. PMID: 25017784
  24. High expression of the GOLPH3 protein is common in early-stage Non-Small-Cell Lung Carcinoma, and is closely associated with tumor progression, increased tumor angiogenesis, and poor survival. PMID: 25081702
  25. The GOPLH3 expression level is highly correlated with Akt/mTOR signaling in human gastric cancer samples. PMID: 25286393
  26. High GOLPH3 expression is associated with metastasis in non-small cell lung cancer. PMID: 25081375
  27. Our recent investigation of the regulation of GOLPH3 revealed a surprising response by the Golgi upon DNA damage that is mediated by DNA-PK and GOLPH3. PMID: 25634214
  28. Study demonstrated that overexpression of GOLPH3 was associated with poor survival in patients with pancreatic ductal adenocarcinoma. PMID: 25104140
  29. The DNA copy number variations disrupt PDZD2 and GOLPH3 genes predominantly expressed in placenta, and it may represent a novel risk factor for recurrent miscarriage. PMID: 24827138
  30. overexpression of GOLPH3 protein is closely related to poorer prognosis in patients with epithelial ovarian cancer. PMID: 25204671
  31. Golgi phosphoprotein 3 (GOLPH3) promotes hepatocellular carcinoma cell aggressiveness by activating the NF-kappaB pathway. PMID: 25385148
  32. These results are the first direct demonstration of the role of GOLPH3 in N-glycosylation to regulate cell biological functions. PMID: 24895123
  33. In this review, GOLPH3 is described as an oncoprotein involved in cell signal transduction. PMID: 24395131
  34. GOLPH3 has a role in triggering signal-mediated incorporation of glycosyltransferases into coatomer-coated vesicles PMID: 25246532
  35. Data indicate that Golgi phosphoprotein 3 (GOLPH3) was overexpressed in hepatocellular carcinoma (HCC) at both the mRNA and protein levels, and high expression of GOLPH3 could be served as a novel and potential prognostic biomarker for HCC patients. PMID: 24867097
  36. Both PKD2 and GOLPH3 play important roles in the progression of human gliomas by promoting cell proliferation. PMID: 25218347
  37. GOLPH3 is associated with prognosis in colorectal cancer patients treated with postoperative 5-fluorouracil-based adjuvant chemotherapy. PMID: 24444035
  38. These results suggest that GOLPH3 expression is likely to have important roles in renal cell carcinoma (RCC) development and progression, and that GOLPH3 is a prognostic biomarker and a promising therapeutic target for RCC. PMID: 24595000
  39. High GOLPH3 expression is associated growth and metastasis of esophageal squamous cancer. PMID: 24175832
  40. GOLPH3 gene expression might play a role in tumorigenesis in epithelial ovarian carcinoma as upregulation of GOLPH3 expression is associated with a more aggressive tumor phenotype. PMID: 24458516
  41. Identification of the DNA-damage-induced Golgi response reveals an unexpected pathway through DNA-PK, GOLPH3, and MYO18A that regulates cell survival following DNA damage. PMID: 24485452
  42. PDZ module mediates direct binding of myosin-18A to GOLPH3, and this interaction in turn modulates the actin binding properties of the N-terminal extension. Thus, myosin-18A can act as an actin cross-linker with multiple regulatory modulators PMID: 23990465
  43. GOLPH3 regulates the migration and invasion of glioma cells though regulation of RhoA. PMID: 23500462
  44. Overexpression of Golgi phosphoprotein-3 is associated with glioblastoma multiforme. PMID: 22972189
  45. Data indicate the potential involvement of GOLPH3 in the development, differentiation, and tumorigenesis of esophageal squamous cell cancer (ESCC), and suggest the possibility of its use as a diagnostic and prognostic marker in ESCC. PMID: 23056210
  46. the overexpression of GOLPH3 is closely related to the progression of gastric cancer and might be regarded as an independent predictor of poor prognosis for gastric cancer PMID: 23132295
  47. Overexpression of GOLPH3 is associated with the transition of prostate cancer from hormone sensitive phase to hormone refractory phase. PMID: 23006319
  48. results suggest GOLPH3 overexpression is associated with poor prognosis for cN0 oral tongue cancer patients and may represent a novel and useful prognostic indicator for cN0 oral tongue cancer PMID: 22905766
  49. GOLPH3 can regulate cell-cell interaction by controlling Golgi retention of C2GnT1. PMID: 23027862
  50. Data indicate that golgi phosphoprotein 3 (GOLPH3) overexpression decreased FOXO1 transcriptional activity. PMID: 22675169

Show More

Hide All

Subcellular Location
Golgi apparatus, Golgi stack membrane; Peripheral membrane protein; Cytoplasmic side. Golgi apparatus, trans-Golgi network membrane; Peripheral membrane protein; Cytoplasmic side. Mitochondrion intermembrane space. Cell membrane. Endosome.
Protein Families
GOLPH3/VPS74 family
Tissue Specificity
Detected in muscle fibers of patients with mitochondrial diseases; not detected in normal muscle fibers.
Database Links

HGNC: 15452

OMIM: 612207

KEGG: hsa:64083

STRING: 9606.ENSP00000265070

UniGene: Hs.408909

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*