Recombinant Human Group IID secretory phospholipase A2 (PLA2G2D), partial

In Stock
Code CSB-EP891566HU
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PLA2G2D
Uniprot No.
Research Area
Metabolism
Alternative Names
2IID; EC 3.1.1.4; GIID sPLA2; Group IID secretory phospholipase A2; Group IID secretory phospholipase A2 precursor ; PA2GD_HUMAN; Phosphatidylcholine 2 acylhydrolase GIID; Phosphatidylcholine 2-acylhydrolase 2D; Phospholipase A2 group IID ; Pla2g2d; PLA2IID; Secretory phospholipase A2s; Secretory type PLA stroma associated homolog; Secretory-type PLA; sPLA ; sPLA2-IID; sPLA2S ; SPLASH ; stroma-associated homolog
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-145aa
Target Protein Sequence
ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
30.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Expressing the recombinant Human PLA2G2D protein in e.coli cells involves inserting a DNA fragment encoding the Human PLA2G2D protein (22-145aa) into a plasmid vector and transferring it to the e.coli cells. Positive cells are screened, cultured, and induced to express the PLA2G2D protein. The protein carries a N-terminal 6xHis-SUMO tag. The cells are lysed to collect the recombinant Human PLA2G2D protein, which is purified through affinity purification and then identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Human PLA2G2D protein exceeds 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Secretory calcium-dependent phospholipase A2 that primarily targets extracellular lipids, exerting anti-inflammatory and immunosuppressive functions. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity) with preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. In draining lymph nodes, selectively hydrolyzes diacyl and alkenyl forms of phosphatidylethanolamines, releasing omega-3 polyunsaturated fatty acids (PUFAs) such as eicosapentaenoate and docosahexaenoate that are precursors of the anti-inflammatory lipid mediators, resolvins. During the resolution phase of acute inflammation drives docosahexaenoate-derived resolvin D1 synthesis, which suppresses dendritic cell activation and T-helper 1 immune response. May act in an autocrine and paracrine manner. Via a mechanism independent of its catalytic activity, promotes differentiation of regulatory T cells (Tregs) and participates in the maintenance of immune tolerance. May contribute to lipid remodeling of cellular membranes and generation of lipid mediators involved in pathogen clearance. Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane.
Gene References into Functions
  1. found to induce PLA2G2D expression in mice and in human monocyte-derived macrophages PMID: 26392224
  2. sPLA(2)-IID is present at the head and midpiece in the human sperm, and its activation seems to be involved in acrosomal exocytosis. PMID: 22240557
  3. phospholipid bilayer permeabilization by the hsPLA2GIID is independent of catalytic activity. PMID: 22490726
  4. The Gly80Ser polymorphism may be associated with the body weight loss seen in chronic obstructive pulmonary disease patients. PLA2G2D-Ser enhances the expression of IL-6 and IL-8 compared with PLA2G2D-Gly. PMID: 19365107
  5. TNF-alpha & IFN-gamma induce gene expression of a novel secretory PLA(2)IIDin human airway epithelial cells. The possibility that it is involved in cytokine-mediated inflammation in the respiratory tract is inferred. PMID: 12396716
  6. The GIID sPLA2 is clustered on human chromosome 1 and is differentially expressed in tissues, suggesting it has unique function. PMID: 15052324
  7. overexpression of human secretory phospholipase A2 group IIA leads to an enhanced delivery of cholesterol from phospholipolysed lipoproteins to the liver PMID: 15379211
  8. These results suggest that sPLA2-IID may be one of the susceptibility genes that contribute to body weight loss in patients with COPD. PMID: 16002569
  9. lipopolysaccharides inhibit interferon gamma-induced gene expression of secretory phospholipase A2 type IID in human monocyte-derived macrophages PMID: 16897354
  10. The distribution pattern of sPLA2S in intact spermatozoa might be an additional parameter for evaluating sperm quality PMID: 18958346

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Phospholipase A2 family
Tissue Specificity
Highly expressed in pancreas and spleen and less abundantly in colon, thymus, placenta, small intestine, and prostate.
Database Links

HGNC: 9033

OMIM: 605630

KEGG: hsa:26279

STRING: 9606.ENSP00000364246

UniGene: Hs.189507

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*