Home
Protein
Recombinant Proteins
Recombinant Human HLA class II histocompatibility antigen, DRB1-3 chain (HLA-DRB1), partial

Recombinant Human HLA class II histocompatibility antigen, DRB1-3 chain (HLA-DRB1), partial

^{In Stock}

Code	CSB-EP365687HU
Abbreviation	Recombinant Human HLA-DRB1 protein, partial
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

HLA-DRB1

Uniprot No.

P01912

Research Area

Immunology

Alternative Names

Human leukocyte antigen DRB1;HLA-DRB1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

31-266aa

Target Protein Sequence

DTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

31.1 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Investigate the complexities of the human immune system with our Recombinant Human HLA-DRB1 protein, a critical component of the HLA class II histocompatibility antigen family. This essential protein is involved in antigen presentation to CD4+ T-lymphocytes, playing a significant role in the adaptive immune response and contributing to the development of various immune-related disorders.

Sourced from E. coli expression systems, our Recombinant Human HLA-DRB1 encompasses a partial sequence (31-266 amino acids) and features an N-terminal 6xHis-tag for efficient purification and detection. With a purity greater than 90% as determined by SDS-PAGE, this high-quality protein ensures reliability and consistency in your research. Available in both liquid and lyophilized powder forms, our Recombinant Human HLA-DRB1 caters to your specific experimental needs.