Recombinant Human Homeobox protein Hox-A2 (HOXA2), partial

Code CSB-YP010652HU
Abbreviation Recombinant Human HOXA2 protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
HOXA2
Uniprot No.
Research Area
Others
Alternative Names
AI324701; homeo box A2; homeobox A2; Homeobox protein Hox-1K; Homeobox protein Hox-A2; Hox-1.11; HOX1.11; HOX1K; Hoxa-2; Hoxa11; HOXA2; HXA2_HUMAN; MGC151482; MGC151484; RATHOX111A
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
26-124aa
Target Protein Sequence
PPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGGRPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
25-35 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Gene References into Functions
  1. Performed mutational analysis of TCOF1, GSC, and HOXA2 to determine the mutational features of the 3 genes in Chinese patients with Treacher Collins syndrome. PMID: 27526242
  2. The role of HOXA2 gene in dominant isolated microtia and the dysmorphogenetic effect of this gene on ear development PMID: 27503514
  3. 5 genomic variants in GSC, HOXA2 and PRKRA were identified through mutational analysis in Chinese patients with microtia. PMID: 28109504
  4. The Hoxa2-mediated decay of RCHY1 involves both the 19S and 20S proteasome complexes PMID: 26496426
  5. HOXA2 acts as a suppressor or TBP-antagonist to inhibit MMP-9 expression; while methylation-mediated inactivation of HOXA2 in NPC derepresses MMP-9 production and increases invasion of NPC cells. PMID: 24243817
  6. we have identified a nonsense mutation (Q235*) in HOXA2 that segregates with bilateral nonsyndromic microtia and hearing loss through three generations of a family in an autosomal dominant pattern. PMID: 23775976
  7. Lack of mutations in the coding region of HOXA2 among the sporadic microtia patients. PMID: 20542577
  8. A missense mutation in the HOXA2 in a consanguineous iranian family with bilateral microtia was reported. PMID: 18394579

Show More

Hide All

Involvement in disease
Microtia, hearing impairment, and cleft palate (MHICP); Microtia with or without hearing impairment (MCRT)
Subcellular Location
Nucleus.
Protein Families
Antp homeobox family, Proboscipedia subfamily
Database Links

HGNC: 5103

OMIM: 604685

KEGG: hsa:3199

STRING: 9606.ENSP00000222718

UniGene: Hs.445239

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*