Recombinant Human Homeobox protein Meis1 (MEIS1), partial

In Stock
Code CSB-YP013686HU
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MEIS1
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Homeo box protein Meis1; Homeobox protein Meis1; Leukemogenic homolog protein; MEIS 1; Meis homeo box 1; Meis homeobox 1; Meis1; Meis1 mouse homolog; Meis1 myeloid ecotropic viral integration site 1 homolog; Meis1 myeloid ecotropic viral integration site 1 homolog mouse; MEIS1 protein; MEIS1_HUMAN; MGC43380; Myeloid ecotropic viral integration site 1 homolog ; WUGSC:H NH0444B04.1
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
180-320aa
Target Protein Sequence
KMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
17.4 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias.
Gene References into Functions
  1. Our results showed that MEIS1 may have a negative role in regulation of MAML1expression during the esophageal squamous cell carcinoma progression. PMID: 28462489
  2. By investigating the role of MEIS1 in ccRCC cells' survival, proliferation, anchorage-independent growth, cell cycle progress, apoptosis and metastasis, in the present work, we propose that MEIS1 may play an important role in clear cell renal cell carcinoma (ccRCC) development. PMID: 28270206
  3. Conclusions MEIS1 variants were associated with an increased risk of RLS in migraine patients. It is possible that an imbalance in iron homeostasis and the dopaminergic system may represent a link between RLS incidence and migraines. PMID: 26643377
  4. We speculate that ACTR2 and MEIS1 might respectively play a role in the pathogenesis of the observed deafness and cardiomyopathy...the patient carrying a 2p14p15 deletion including OTX1 had normal kidneys and genitalia, thus confirming that OTX1 haploinsufficiency is not invariably associated with genitourinary defects. PMID: 28599093
  5. results reveal that MEIS1, through induction of SYTL1, promotes leukemogenesis and supports leukemic cell homing and engraftment, facilitating interactions between leukemic cells and bone marrow stroma. PMID: 27018596
  6. Meis1 regulates expression and activation of Syk in Hoxa9-driven leukemia. PMID: 28399410
  7. Here we present the result of a 4-stage genome-wide association study composed of 5,953 adolescent idiopathic scoliosis patients and 8,137 controls. Overall, we identified three novel susceptible loci including rs7593846 at 2p14 near MEIS1 , rs7633294 at 3p14.1 near MAGI1 and rs9810566 at 3q26.2 near TNIK PMID: 28334814
  8. Results show that Meis1 may have a positive feedback with Msi1 during the esophageal squamous cell carcinoma progression. PMID: 27142513
  9. Meis1 functions as an important regulator during the progression of acute myeloid leukemia. PMID: 28054140
  10. MEIS1 drivesMalignant peripheral nerve sheath tumors cell growth via the transcription factor ID1, thereby suppressing expression of the cell cycle inhibitor p27(Kip) and maintaining cell survival. PMID: 27333032
  11. it was observed that ER stimulated gene expression by interacting with MEIS1 and FOXP3, and ER inhibited gene expression by interacting with THRB and GRHL1. PMID: 27035558
  12. this is the first report on the MEIS1 gene in esophageal squamous cell carcinoma PMID: 26314854
  13. Infant patients with acute lymphoblastic leukemia expressing low levels of MEIS1 had a superior outcome over patients expressing high levels of the protein. PMID: 26681762
  14. Our findings confirm an association between the BTBD9, MEIS1, and MAP2K5/SKOR1 SNPs and periodic limb movements of sleep in an elderly cohort. PMID: 26498236
  15. It was observed that RE-IIBP induces MEIS1-mediated apoptosis, which was dependent on H2BK120 ubiquitination by RNF20. PMID: 26206755
  16. Studies implicate PBX3/MEIS1 interaction as a driver of cell transformation and leukemogenesis, and that this axis may play a critical role in the regulation of the core transcriptional programs activated in MLL-rearranged and HOX-overexpressing AML. PMID: 26747896
  17. The NK AML patients with NPM1 mutations exhibited elevated HOXA4 methylation and expression levels of HOXA5 and MEIS1 compared with the NPM1 wildtype patients. PMID: 25585874
  18. Pbx3 contributes to Hoxa9 leukemogenesis through stabilization of the Meis1 protein. PMID: 26130510
  19. HOXA9 and MEIS1 overexpression are inversely correlated with relapse and overall survival, so the genes could become useful predictive markers of the clinical course of pediatric acute leukemias. PMID: 26059450
  20. Data indicate that Meis homeobox 1 (MEIS1) knockdown by lentiviral-shRNA significantly inhibited the growth in leukemia cell lines. PMID: 25740828
  21. MEIS1 expression induces lineage commitment towards a megakaryocyte-erythroid progenitor cell fate in common myeloid progenitor cells through activation of genes that define a megakaryocyte-erythroid-specific gene expression program. PMID: 25107888
  22. Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD PMID: 25142570
  23. MEIS1 is likely a key mediator between sex steroid and genes for uterine receptivity. Diminished endometrium MEIS1 expression may contribute to implantation failure in endometriosis. PMID: 24985084
  24. statistically significantly lower expression of miR-204 in all nephroblastomas investigated might point to an involvement of miR-204 in the regulation of MEIS1 in nephroblastomas PMID: 24617557
  25. data link MEIS1 loss of function to the etiopathology of RLS, highlight how combined sequencing and systematic functional annotation of rare variation at GWAS loci can detect risk burden PMID: 24995868
  26. BRAF p.V600E colon tumors showed significant MEIS1 promoter methylation, which was associated with decreased MEIS1 gene expression. PMID: 24244575
  27. MEIS1 in hematopoiesis and contributes to its aberrant expression in acute leukemia PMID: 24022755
  28. Hoxa7, Hoxa9 and Hox cofactor Meis1 were identified as AP-2alpha target genes, which are involved in myeloid leukemogenesis. PMID: 23660297
  29. [review] It is possible that Meis1 contributes to the quiescent state of adult cardiomyocytes by regulating redox homeostasis. PMID: 23868827
  30. Data indicate that dynamin 3 (DNM3) harbors MEIS1 binding sites and is associated with differences in mean platelet volume (MPV). PMID: 22972982
  31. up-regulation of MEIS1 is important for sustaining proliferation of leukemic cells and that down-regulation of MEIS1 PMID: 22185299
  32. findings show that HOXA9 and MEIS1 are direct targets of miRNA-196b, a microRNA located adjacent to and co-expressed with HOXA9, in MLL-rearranged leukaemic cells PMID: 22353710
  33. the cellular context in which HOX/MEIS1 is overexpressed appears to be very important, and other relevant genes are most likely required as well to maintain the expanding capacity of the CD34thorn NPMcthorn acute myeloid leukemia cells PMID: 21986840
  34. Data show that MEIS1D, a Meis1 isoform, is expressed in colon. PMID: 21858198
  35. Variants in MEIS1, BTBD9, and MAP2K5/SKOR1 confer a significant risk of restless legs syndrome in a United States population. PMID: 21925394
  36. In the German sample, variants in MEIS1 and BTBD9 were associated with Restless legs syndrome in end stage renal disease PMID: 21572129
  37. These findings indicate that Meis1 works as a transcription factor for mitochondrial genes in pancreatic cancer cells. PMID: 21703237
  38. A link is established between the restless legs syndrome-associated MEIS1 gene and iron metabolism. PMID: 21710629
  39. Several targets of MLL fusions, MEIS1, HOXA7, HOXA9, and HOXA10 are functionally related and have been implicated in leukemias. Each of the four genes was knocked down separately in the precursor B-cell leukemic line RS4;11 expressing MLL-AF4. PMID: 21518888
  40. Screening of the coding regions of MEIS1 in patients with RLS revealed 3 novel variants. PMID: 21422461
  41. ETS transcription factor ELF1 is an important positive regulator of MEIS1 expression PMID: 20600580
  42. GSK-3 maintains the MLL leukemia stem cell transcriptional program by promoting the conditional association of CREB and its coactivators TORC and CBP with homedomain protein MEIS1, which in turn facilitates HOX-mediated transcription and transformation. PMID: 20541704
  43. co-operation between TLX1 and MEIS proteins may have a significant role in T-cell leukemogenesis. PMID: 19559479
  44. Data demonstrated that overexpressed PBX1 and MEIS1 increased endogenous SOX3 protein expression in both uninduced and RA-induced NT2/D1 cells. PMID: 19799567
  45. these studies demonstrate that the homeodomain proteins, MEIS1, PBX1B, and PBX2, play an important role in megakaryocytic gene expression PMID: 12609849
  46. Hoxa9 and Hoxa7 as well as the Hox coregulators Meis1 and Pbx3 among the targets upregulated by MLL-ENL-ERtm in conditionally transformed cells PMID: 14701735
  47. Data report novel nucleoporin 98 fusions with homeobox (HOX)A10, HOXB3 and HOXB4, and describe the results of coexpression of these proteins with the Hox cofactor Meis1 in leukemic induction. PMID: 14966272
  48. found a constant downregulation of the Meis 1 gene mRNA in AML1-ETO acute myeloid leukemias and in those cases harboring in frame mutations in the bZIP domain of CEBPalpha PMID: 15103390
  49. suggest that MLL aberrations may regulate MEIS1 and HOXA9 gene expression in ALL-derived cell lines, while AML-derived cell lines express these genes independently of the MLL status PMID: 15160920
  50. advantage to Meis1-HoxA9 coexpressing cells in vivo, leading to leukemogenesis. PMID: 15479723

Show More

Hide All

Involvement in disease
Restless legs syndrome 7 (RLS7)
Subcellular Location
Nucleus.
Protein Families
TALE/MEIS homeobox family
Tissue Specificity
Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also expressed at high leve
Database Links

HGNC: 7000

OMIM: 601739

KEGG: hsa:4211

STRING: 9606.ENSP00000272369

UniGene: Hs.526754

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*