Recombinant Human Homeobox protein VENTX (VENTX)

Code CSB-EP528513HU
Abbreviation Recombinant Human VENTX protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
VENTX
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
hemopoietic progenitor homeobox protein VENTX2; Homeobox protein VENTX; HPX42B; MGC119910; MGC119911; NA88A; VENT homeobox homolog; VENT like homeobox 2; VENT like homeobox protein 2; VENT-like homeobox protein 2; VENTX; VENTX_HUMAN; VENTX2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-258aa
Target Protein Sequence
MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.6kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in ventralization.
Gene References into Functions
  1. Findings suggest potential applications of homeobox protein VentX (VentX)-regulated tumor-associated macrophages (TAMs) in cancer immunotherapy. PMID: 29872044
  2. VENTX impairs expression of genes involved in erythroid differentiation and is highly expressed in patients with acute erythroid leukemia. PMID: 27888632
  3. VentX induces apoptosis of cancer cells in a p53-independent manner PMID: 27175592
  4. Data suggest that homeobox transcription factor VentX may be a target to modulate Dendritic cells (DCs) functions and manage inflammatory diseases. PMID: 24706756
  5. VentX regulates critical cell cycle regulators and Wnt downstream genes previously implicated in HSC/MPP proliferation and expansion. PMID: 22791709
  6. Results provide mechanistic insight into the crucial roles of VentX in macrophage differentiation and proinflammatory activation and suggest that dysregulation of VentX may play a role in the pathogenesis of autoimmune diseases. PMID: 21670496
  7. Data show that VentX is a direct transcriptional activator of p53-p21 and p16ink4a-Rb tumor suppression pathways. PMID: 21325273
  8. these data extend our insights into the function of embryonic mesodermal factors in human postnatal hematopoiesis and indicate a role for VENTX in normal and malignant myelopoiesis. PMID: 20833819
  9. a potential role of VentX in the clinical behavior of hematopoietic malignancies. PMID: 20028861

Show More

Hide All

Subcellular Location
Nucleus.
Tissue Specificity
Expressed in bone marrow of patients recovering from chemotherapy. Also expressed in an erythroleukemia cell line.
Database Links

HGNC: 13639

OMIM: 607158

KEGG: hsa:27287

STRING: 9606.ENSP00000357556

UniGene: Hs.125231

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*