Recombinant Human Immunoglobulin iota chain(VPREB1)

Code CSB-EP025887HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P12018
Relevance Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CD179 antigen-like family member A Protein VPreB1 V(pre)B protein Short name:VpreB protein CD_antigen: CD179a
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAARTRVP
Research Area Others
Source E.coli
Gene Names VPREB1
Protein Names Recommended name: Immunoglobulin iota chain Alternative name(s): CD179 antigen-like family member A Protein VPreB1 V(pre)B protein Short name= VpreB protein CD_antigen= CD179a
Expression Region 20-145aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 30.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.
Protein Families Immunoglobulin superfamily
Tissue Specificity Only expressed by pre-B-cells.
Database Links

HGNC: 12709

OMIM: 605141

KEGG: hsa:7441

STRING: 9606.ENSP00000385361

UniGene: Hs.247979

Q&A and Customer Reviews

Q&A
Q:

I'm interested in 1.5mg of CSB-EP025887HU. And we would like to see if we could get it in PBS vs Tris Buffer + Glycerol as they’re using it for immunizations.

A:
Very nice to receive your inquiry.
Our standard buffer is 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0 50% glycerole. If you plan to use this protein for immunization, glycerol content can not be too high.
We could supply this protein in PBS. It all depend on your request. The price and the lead time won't change. Please remark this request when sending your PO.
Customer Reviews

Related Products

VPREB1 Antibodies

VPREB1 Antibodies for Homo sapiens (Human)

VPREB1 Proteins

VPREB1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.