Recombinant Human Immunoglobulin iota chain (VPREB1)

In Stock
Code CSB-EP025887HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
VPREB1
Uniprot No.
Research Area
Others
Alternative Names
CD179 antigen like family member A; CD179 antigen-like family member A; CD179a; IGI; IGVPB; Immunoglobulin iota chain; Pre B lymphocyte 1; pre-B lymphocyte 1; Protein VPreB1; V(pre)B protein; VPREB 1; VPREB; VpreB protein; VPREB_HUMAN; VPREB1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
20-145aa
Target Protein Sequence
QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAARTRVP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
30.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I'm interested in 1.5mg of CSB-EP025887HU. And we would like to see if we could get it in PBS vs Tris Buffer + Glycerol as they’re using it for immunizations.

A:
Very nice to receive your inquiry.
Our standard buffer is 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0 50% glycerole. If you plan to use this protein for immunization, glycerol content can not be too high.
We could supply this protein in PBS. It all depend on your request. The price and the lead time won't change. Please remark this request when sending your PO.

Target Background

Function
Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.
Gene References into Functions
  1. Irrespective of subtype, Acute Lymphoblastic Leukemia with high levels of IGHM, IGLL1 and VPREB1 are arrested at the pre-B stage and correlate with good prognosis in high-risk pediatric B-cell precursor acute lymphoblastic leukemia. PMID: 27611867
  2. VPREB1 focal deletions are common in B-ALL and occur independent of V(D)J light chain recombination. Focal deletions of VPREB1 correlate with decreased expression levels and high-risk patients with focal deletions tend to have poorer overall survival PMID: 23881307
  3. The proportion of the individuals with <2 copies of the VPREB1 gene was significantly higher in the patient group than that in the controls, while that of the individuals with >2 copies was lower in the patient group than that in the controls. PMID: 21144590
  4. The 5' region of the VpreB gene contains a promoter which displays higher relative activity in preB cells compared with cells at other stages or from other lineages. PMID: 11994467
  5. Pre-B cell integrins and their stromal cell ligands together with the pre-B cell receptor and galectin-1 form a homogeneous lattice at the contact area between bone marrow pre-B and stromal cells. PMID: 16818733

Show More

Hide All

Subcellular Location
Endoplasmic reticulum.
Protein Families
Immunoglobulin superfamily
Tissue Specificity
Only expressed by pre-B-cells.
Database Links

HGNC: 12709

OMIM: 605141

KEGG: hsa:7441

STRING: 9606.ENSP00000385361

UniGene: Hs.247979

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*