Recombinant Human Importin subunit alpha-5 (KPNA1), partial

In Stock
Code CSB-EP012483HU1
Abbreviation Recombinant Human KPNA1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
KPNA1
Uniprot No.
Alternative Names
IMA5_HUMAN; Importin alpha 1 subunit; Importin alpha 5; Importin alpha S1; Importin subunit alpha-5; N-terminally processed; IPO A5; IPOA 5; IPOA5; Karyopherin alpha 1; Karyopherin alpha 1 subunit; Karyopherin subunit alpha-1; KPNA 1; KPNA1; mSRP 1; mSRP1; NPI 1; NPI-1; NPI1; Nucleoprotein interactor 1; RAG cohort protein 2; RCH 2; RCH2; Recombination activating gene cohort 2; SRP 1; SRP1 beta; SRP1-beta
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
8-538aa
Target Protein Sequence
NFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
63.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS.
Gene References into Functions
  1. Importin alpha1 is specifically required for the nuclear localization of several important HSV1 proteins, capsid assembly, and capsid egress into the cytoplasm, and may become rate limiting in situ upon infection at low multiplicity or in terminally differentiated cells such as neurons. PMID: 29304174
  2. Karyoppherins constitute integral constituents of the nuclear pore complex whose barrier, transport, and cargo release functionalities establish a continuum under a mechanism of Kap-centric control. PMID: 28864541
  3. Data suggest that EV71 infection in enterocytes does not inhibit phosphorylation of STAT1/2 induced by IFN-beta, but p-STAT1/2 transport into the nucleus is significantly blocked; EV71 infection in enterocytes down-regulates expression of KPNA1 and induces degradation of cellular KPNA1 via caspase-3. [EV17 = Enterovirus 71] PMID: 28455446
  4. Data show that cytoskeleton associated protein 5 (chTOG) only weakly promotes importin-regulated microtubule nucleation, but acts synergistically with TPX2 protein. PMID: 26414402
  5. BIG3 may block the KPNAs (KPNA1, KPNA5, and KPNA6) binding region(s) of PHB2. PMID: 26052702
  6. miR-223 downregulation promotes glomerular endothelial cell activation by upregulating importin alpha4 and alpha5 in IgA nephropathy PMID: 24284509
  7. Bel1 fragment with residues 215-223, which bears the NLS, interacts with KPNA1, KPNA6, and KPNA7. PMID: 25272585
  8. Results indicate CTNNBL1 as a unique selective nuclear localization signals (NLSs)-binding protein with striking differences from karyopherin-alphas. PMID: 24269683
  9. This supports the notion that de novo mutations KPNA1 in are extremely rare in schizophrenia PMID: 23425335
  10. LRRC59 facilitates transport of cytosolic FGF1 through nuclear pores by interaction with Kpns and movement of LRRC59 along the ER and NE membranes PMID: 22321063
  11. mTOR and protein phosphatase 2A catalytically control the constitutive nuclear import of latent STAT1 by KPNA1, which are key modulators of STAT1 expression and apoptosis. PMID: 22399302
  12. the requirement for and the regulation of CAS in the functioning of the Vpr-Impalpha complex PMID: 22110766
  13. Nucleoporin Nup50 stabilizes closed conformation of armadillo repeat 10 in importin alpha5. PMID: 22130666
  14. The ability of hnRNP C1/C2 to bind KPNA1 is diminished in the presence of VP24, and cells transiently expressing VP24 redistribute hnRNP C1/C2 from the nucleus to the cytoplasm. PMID: 21987768
  15. This study reports the identification and classification of importin alpha 5 -interacting proteins in brain cells. PMID: 21307607
  16. The mammalian E1 subunits can be imported separately, identify nuclear localization signals (NLSs) in Aos1 and in Uba2, and demonstrate that their import is mediated by importin alpha/beta in vitro and in intact cells. PMID: 21209321
  17. Impalpha5 acts as a chaperone until Influenza a virus nucleoprotein (NP) is delivered in the nucleus for viral RNA encapsidation. PMID: 20974480
  18. Study identified the sequences KKKRR, KKKRK, and KKRKK as the optimal sequences for binding to this site for mouse importin-alpha2, human importin-alpha1, and human importin-alpha5, respectively. PMID: 20406804
  19. The papillomavirus E2 proteins preferentially interacted with alpha importins 3 and 5, and showed very weak or no interaction with the other three widely expressed alpha importins (alpha1, alpha 4, and alpha 7). PMID: 20193720
  20. The VP24 IFN antagonist function of ebolavirus requires the ability of VP24 to interact with KPNalpha. PMID: 19889762
  21. arginine/lysine-rich nuclear localization signals mediate interactions between dimeric STATs and importin alpha 5 PMID: 12048190
  22. one importin alpha molecule is able to use either its N- or C-terminal arm repeats for binding various NLS containing proteins PMID: 12740372
  23. Importin alpha5 and alpha7 bind to Stat3 upon cytokine stimulation. PMID: 16298512
  24. the karyopherin alpha NPI-1, a nuclear import adaptor, bound more strongly to Epstein-Barr virus nuclear antigen 1 Ser385-phosphorylated nuclear localization signal than to any other phosphorylated or nonphosphorylated forms PMID: 16439554
  25. Here, VP24 is demonstrated to interact with endogenous karyopherin alpha1 and inhibits its interaction with STAT1. PMID: 17928350
  26. importins alpha5 and beta1 associate with Nrf2, an interaction that was blocked by the nuclear import inhibitor SN50 PMID: 18238777
  27. NPI-1 subfamily accumulates in the nucleus in response to oxidative stress, like importin alpha1/Rch1. PMID: 18707546
  28. significant KPNA1-, NLRP1- and NLRP3-gene expression phenotypes associated with human genotypes of Crohn's disease, Huntington's disease and rheumatoid arthritis PMID: 19001869
  29. PB2 interaction with alpha-importins is required for virus RNA replication. PMID: 19066626
  30. Karyopherin alpha 1 is a putative substrate of the RAG1 ubiquitin ligase. PMID: 19118899

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Importin alpha family
Tissue Specificity
Expressed ubiquitously.
Database Links

HGNC: 6394

OMIM: 600686

KEGG: hsa:3836

STRING: 9606.ENSP00000343701

UniGene: Hs.161008

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*