Recombinant Human Intelectin-1 (ITLN1)

In Stock
Code CSB-EP851976HU
Abbreviation Recombinant Human ITLN1 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ITLN1
Uniprot No.
Research Area
Cardiovascular
Alternative Names
(ITLN-1)(Endothelial lectin HL-1)(Galactofuranose-binding lectin)(Intestinal lactoferrin receptor)(Omentin)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
19-298aa
Target Protein Sequence
TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lectin that specifically recognizes microbial carbohydrate chains in a calcium-dependent manner. Binds to microbial glycans that contain a terminal acyclic 1,2-diol moiety, including beta-linked D-galactofuranose (beta-Galf), D-phosphoglycerol-modified glycans, D-glycero-D-talo-oct-2-ulosonic acid (KO) and 3-deoxy-D-manno-oct-2-ulosonic acid (KDO). Binds to glycans from Gram-positive and Gram-negative bacteria, including K.pneumoniae, S.pneumoniae, Y.pestis, P.mirabilis and P.vulgaris. Does not bind human glycans. Probably plays a role in the defense system against microorganisms (Probable). May function as adipokine that has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. Increases AKT phosphorylation in the absence and presence of insulin. May interact with lactoferrin/LTF and increase its uptake, and may thereby play a role in iron absorption.
Gene References into Functions
  1. chemerin and leptin are elevated and omentin-1 and visfatin levels are decreased in Gestational diabetes mellitus women complicated by obesity. PMID: 29337272
  2. Study shows omentin Val/Val (mutant homozygote) genotype increases predisposition to acne vulgaris by probably disrupting overall protein function of omentin. PMID: 30301508
  3. The study showed for the first time serum omentin and visfatin levels to be decreased after lung transplantation in end-stage lung disease patients PMID: 29277835
  4. ITLN1, PPARg AND TNFa GENE EXPRESSION IN VISCERAL ADIPOSE TISSUE. PMID: 30188100
  5. Omentin may play a role in the pathophysiology of preterm births but it is not involved in the mechanism of preterm premature rupture of the membranes. PMID: 28440092
  6. Loss of Omentin-1 expression is Associated with Carotid Plaque Instability among Ischemic Stroke Patients. PMID: 29225325
  7. Val109Asp polymorphic marker of intelectin 1 gene is associated with abdominal obesity. PMID: 29482534
  8. Reduced serum omentin-1 is associated with inflammatory mechanism and insulin resistance in the pathogenesis of diabetic nephropathy in type 2 diabetes mellitus patients. PMID: 28864059
  9. The aims of this study were to evaluate and correlate circulating chemerin, apelin, vaspin, and omentin-1 levels in obese type 2 diabetic Egyptian patients with coronary artery stenosis (CAS), and to assess their usefulness as noninvasive diagnostic biomarkers. PMID: 28957639
  10. six-month lifestyle weight loss intervention significantly increased serum levels in obese children PMID: 28833541
  11. ITLN1 expression was significantly increased in asthmatic airways and in lesional skin of atopic dermatitis patients PMID: 28224996
  12. Plasma omentin-1 level was significantly higher in patients with good coronary collateral circulation (CCC) than those with poor CCC (566.57+/-26.90 vs. 492.38+/-19.70 ng/mL, p=0.024). Besides, omentin-1 was positively correlated with total cholesterol, high-density lipoprotein, and gensini score but inversely with hyperlipidemia and body mass index (all p values0.05). PMID: 28123148
  13. In conclusion, our study, which focused on hepatic FGF21 and omentin-1 mRNA expression, confirmed marked expression of both molecules in the liver of morbidly obese patients with NAFLD. PMID: 28820393
  14. Myocardial injury leads to a decrease in ITLN1 expression in the heart and a corresponding increase in plasma levels PMID: 28687077
  15. the effects of omentin-1 on KLF2 expression are mediated by p53. PMID: 29408455
  16. Omentin levels are increased in cirrhotic patients without portal vein thrombosis, but do not influence platelet activity. PMID: 28465646
  17. Omentin-1 levels are closely associated with the endogenous insulin reserve and may be used in follow-up of patients. PMID: 28073124
  18. Omentin expression increases in the epicardial adipose tissueof non-obese coronary artery disease patients, despite a decrease in plasma levels, suggesting that omentin may play a role in the pathogenesis of coronary artery disease PMID: 27450783
  19. Omentin-1 concentrations may be related to increased stroke risk PMID: 27298015
  20. A decreased level of circulating omentin negatively correlated with white blood cells and procalcitonin in patients with acute respiratory distress syndrome. PMID: 27607575
  21. Serum levels of omentin-1 were positively associated with increases in glycemia and incident type 2 diabetes in an older population. PMID: 28679518
  22. These findings suggested that elevated serum omentin levels were only very mildly related to the changes in cardiac volume and function in chronic heart failure patients PMID: 27270246
  23. Data suggest that circulating omentin-1 levels are lower in patients with PCOS (polycystic ovary syndrome) as compared to control subjects; circulating omentin-1 levels appear to correlate with insulin resistance but do not appear to correlate with overweight/obesity in these patients. [META-ANALYSIS] PMID: 27908216
  24. In conclusion, DAB2 and Intelectin-1 are newly identified positive markers of mesothelioma and have potential to be included in future immunohistochemical marker panels for differentiation of epithelioid mesothelioma from pulmonary adenocarcinoma PMID: 28394802
  25. This study showed that consumption of olive oil-rich diet tended to increase omentin and adiponectin in comparison with the usual diet. PMID: 27931137
  26. Omentin concentrations were inversely associated with MMP-3 levels in rheumatoid arthritis patients. This relationship was influenced by population origin, rheumatoid arthritis activity and erythrocyte sedimentation rate. PMID: 27476070
  27. High omentin expression is associated with Colorectal Cancer. PMID: 27216184
  28. Our results indicate that the Asp allele of Val109Asp (T allele of rs2274907) is more frequent among men with coronary artery disease than healthy men, so it is possibly a risk factor for coronary artery disease in men only. PMID: 28325076
  29. In type 2 diabetes mellitus, both chemerin and omentin enhance the body sensitivity to insulin, which results in increased glucose uptake and increased expression of the omentin gene was reported in nasal polyps and mesothelioma. PMID: 27516571
  30. High omentin expression is associated with osteoporosis. PMID: 27614458
  31. There was no difference in serum chemerin, vaspin and omentin-1 between polycystic ovary syndrome patients and healthy controls. PMID: 27225862
  32. Atorvastatin increased serum omentin-1 concentrations in patients with coronary artery disease in a dose-dependent manner. PMID: 27749321
  33. Omentin-1 might exert a negative effect on bone remodelling in girls with anorexia nervosa by inhibiting both bone formation and resorption. The OPG/sRANKL system plays an important role in the latter. PMID: 26662650
  34. Low serum Omentin-1 level is Associated with Dilated Cardiomyopathy. PMID: 27313334
  35. omentin, as compared to vaspin, seems to provide a better predictor of insulin resistance in obese individuals. PMID: 27449535
  36. Data suggest that nonlinear resistance training or aerobic interval training for 12 weeks produces no significant changes in serum levels of omentin-1 and interleukin-18 in obese men; however, during a 4-week detraining period, omentin-1 decreases significantly and IL-18 increases significantly. PMID: 27636349
  37. Omentin-1 expression in patients with coronary artery disease was lower in epicardial adipose tissue adjacent to coronary stenotic segments than non-stenotic segments PMID: 27352781
  38. omentin reduces the development of atherosclerosis by reducing inflammatory response of macrophages through the Akt-dependent mechanisms PMID: 26714927
  39. Omentin-1 levels were markedly reduced in coronary endothelium and epicardial fat but increased in plasma and atheromatous plaques (macrophages/SMCs) in coronary artery disease (CAD) patients compared with non-CAD patients PMID: 26790473
  40. The mean serum omentin-1 concentration in adolescent girls with anorexia nervosa was higher than that of controls and obese girls. PMID: 25804090
  41. Omentin levels were lower in both obese and non-obese PCOS patients compared to healthy controls. PMID: 26291814
  42. Data show that the circulating omentin-1 levels were dramatically decreased in renal cell carcinoma (RCC) patients. PMID: 26539805
  43. Although no significant difference was detected regarding omentin Val109Asp polymorphism, Val/Val genotype frequency was found to be more in patient group than control group. It may be speculated that Val/Val genotype increases the tendency for CAD. PMID: 24370683
  44. Plasma omentin-1 concentrations were decreased in non-obese polycystic ovary syndrome individuals PMID: 26514948
  45. Data suggest serum omentin/ITLN1 levels are down-regulated in elderly population (ages 61-82 years) with type 2 diabetes and polyneuropathy, independently of established risk factors of polyneuropathy; ITLN1 is positively correlated with adiponectin. PMID: 26094489
  46. Serum omentin was associated with cardiac autonomic neuropathy in type 2 diabetes patients. PMID: 26466574
  47. analysis of expression of maternal omentin-1 in humans and in the rat animal model PMID: 26144294
  48. Lower levels of serum omentin in patients with pseudoexfoliation syndrome compared with healthy subjects may support the theory of systemic nature of the disease. PMID: 25264991
  49. A decrease in omentin-1 levels could be an independent mortality risk factor in patient with diabetes on hemodialysis. PMID: 26293449
  50. This study clearly indicates that acute aerobic exercise elicits a pro-inflammatory response (e.g. CHI3L1) with a lower anti-inflammatory effect (e.g. ITLN-1) in obese individuals. PMID: 26316585

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Secreted.
Tissue Specificity
Highly expressed in omental adipose tissue where it is found in stromal vascular cells but not in fat cells but is barely detectable in subcutaneous adipose tissue (at protein level). Highly expressed in the small intestine. Also found in the heart, testi
Database Links

HGNC: 18259

OMIM: 609873

KEGG: hsa:55600

STRING: 9606.ENSP00000323587

UniGene: Hs.50813

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*