Product Details

Purity

Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.

Target Names

ITIH4

Uniprot No.

Q14624

Research Area

others

Alternative Names

35 kDa inter-alpha-trypsin inhibitor heavy chain H4; gp120; H4P; IHRP; Inter-alpha-inhibitor heavy chain 4; Inter-alpha-trypsin inhibitor family heavy chain-related protein; Inter-alpha-trypsin inhibitor heavy chain H4; inter-alpha-trypsin inhibitor, heavy chain-like, 1; ITI heavy chain H4; ITI-HC4; ITIH4; ITIH4_HUMAN; ITIHL1; OTTHUMP00000197120; OTTHUMP00000197121; OTTHUMP00000213834; OTTHUMP00000213869; PK-120; PK120; Plasma kallikrein sensitive glycoprotein 120; PRO1851

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

689-930aa

Target Protein Sequence

RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.9 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The fusion tag N-terminal 6xHis tag gene was added to the gene sequence corresponding to the yeast of the human ITIH4 protein to form the recombinant DNA. The recombinant DNA was cloned into the expression vector and then transfected into the yeast cells for expression. Following purification, the product is the recombinant human ITIH4 protein carrying N-terminal 6xHis tag. The SDS-PAGE assessed the purity of this recombinant ITIH4 protein up to 85%. It had an apparent molecular weight of approximately 30 kDa.

ITIH4 is a gene encoding a protein called inter-alpha-trypsin inhibitor heavy chain H4 in human and belongs to ITIH family, which was associated with inflammation and carcinogenesis. This gene is located in a cluster of related inter alpha trypsin inhibitor genes on chromosome 14. The protein encoded by this gene is a 120 kDa acute-phase glycoprotein produced primarily in the liver. ITIH4 is involved in liver development and stabilization of the extracellular matrix (ECM), and its expression is altered in liver disease.

Target Background

Function

Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.

Gene References into Functions

Low ITIH4 expression is associated with Hepatocellular Carcinoma. PMID: 28828637
this report has further supported for associations of genetic variants in the ITIH4 and CALN1 genes with schizophrenia and provided the first evidence that the variants regulate ITIH4 AND CALN1 expression in the dorsolateral prefrontal cortex PMID: 26991396
ITIH4 peptide isoform as a preterm birth biomarker and its associated SNP implications PMID: 26408095
Serum ITIH4 may be a PM10-specific biomarker in COPD and may be related to inflammation. PMID: 25977605
Four novel body mass index-associated loci near the KCNQ1(rs2237892), ALDH2/MYL2 (rs671, rs12229654), ITIH4 (rs2535633) and NT5C2 (rs11191580) genes are identified in East Asian-ancestry populations. PMID: 24861553
Worse survival among HCC patients with low ITIH4. PMID: 24836184
Isoform-specific ITIH4 glycosylation and utilization of O-glycosylation sites on ITIH4 differs between cell lines and serum. PMID: 24884609
Expression of the 85 kDa ITIH4 was substantial in amyotrophic lateral sclerosis compared with controls or patients with muscular dystrophy, Alzheimer diseases, or Parkinson diseases PMID: 23436019
A truncated fragment of inter-alpha-trypsin inhibitor heavy chain 4 was the sole protein found to be significantly enhanced in the prostate cancer patients compared to the controls. PMID: 23417432
Findings suggest that ITI-H4 expression may be used as a biomarker, which could facilitate the development of novel diagnostic and therapeutic tools. PMID: 21331437
Genetic variation at ITIH4 locus is one of the likely candidate determinants for plasma cholesterol metabolisms PMID: 14661079
ITIH4 and MTJ1 co-immunoprecipitate from total liver protein extracts and SANT domain of HTJ1 protects the ITIH4(588-930) recombinant fragment PMID: 16271702
The inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4) protein was significantly present more in interstial cystitis than controls PMID: 18455532
ITIH4 is an anti-inflammatory protein, and suggests that further investigation into its potential use in the diagnosis and prognosis of acute ischemic stroke is warranted. PMID: 19263524

Hide All

Subcellular Location

Secreted.

Protein Families

ITIH family

Tissue Specificity

Liver specific.

Database Links

HGNC: 6169

OMIM: 600564

KEGG: hsa:3700

STRING: 9606.ENSP00000266041

UniGene: Hs.709406

Code	CSB-YP617923HU
Abbreviation	Recombinant Human ITIH4 protein, partial
MSDS	MSDS Datasheet
Size	$368
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP617923HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) ITIH4. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP617923HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) ITIH4. The purity of ITIH4 was greater than 90% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4)，partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage