Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial

In Stock
Code CSB-EP617923HU
Abbreviation Recombinant Human ITIH4 protein, partial
MSDS
Size US$306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
others
Alternative Names
35 kDa inter-alpha-trypsin inhibitor heavy chain H4; gp120; H4P; IHRP; Inter-alpha-inhibitor heavy chain 4; Inter-alpha-trypsin inhibitor family heavy chain-related protein; Inter-alpha-trypsin inhibitor heavy chain H4; inter-alpha-trypsin inhibitor, heavy chain-like, 1; ITI heavy chain H4; ITI-HC4; ITIH4; ITIH4_HUMAN; ITIHL1; OTTHUMP00000197120; OTTHUMP00000197121; OTTHUMP00000213834; OTTHUMP00000213869; PK-120; PK120; Plasma kallikrein sensitive glycoprotein 120; PRO1851
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
689-930aa
Target Protein Sequence
RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Citations

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Gene References into Functions
  1. Low ITIH4 expression is associated with Hepatocellular Carcinoma. PMID: 28828637
  2. this report has further supported for associations of genetic variants in the ITIH4 and CALN1 genes with schizophrenia and provided the first evidence that the variants regulate ITIH4 AND CALN1 expression in the dorsolateral prefrontal cortex PMID: 26991396
  3. ITIH4 peptide isoform as a preterm birth biomarker and its associated SNP implications PMID: 26408095
  4. Serum ITIH4 may be a PM10-specific biomarker in COPD and may be related to inflammation. PMID: 25977605
  5. Four novel body mass index-associated loci near the KCNQ1(rs2237892), ALDH2/MYL2 (rs671, rs12229654), ITIH4 (rs2535633) and NT5C2 (rs11191580) genes are identified in East Asian-ancestry populations. PMID: 24861553
  6. Worse survival among HCC patients with low ITIH4. PMID: 24836184
  7. Isoform-specific ITIH4 glycosylation and utilization of O-glycosylation sites on ITIH4 differs between cell lines and serum. PMID: 24884609
  8. Expression of the 85 kDa ITIH4 was substantial in amyotrophic lateral sclerosis compared with controls or patients with muscular dystrophy, Alzheimer diseases, or Parkinson diseases PMID: 23436019
  9. A truncated fragment of inter-alpha-trypsin inhibitor heavy chain 4 was the sole protein found to be significantly enhanced in the prostate cancer patients compared to the controls. PMID: 23417432
  10. Findings suggest that ITI-H4 expression may be used as a biomarker, which could facilitate the development of novel diagnostic and therapeutic tools. PMID: 21331437
  11. Genetic variation at ITIH4 locus is one of the likely candidate determinants for plasma cholesterol metabolisms PMID: 14661079
  12. ITIH4 and MTJ1 co-immunoprecipitate from total liver protein extracts and SANT domain of HTJ1 protects the ITIH4(588-930) recombinant fragment PMID: 16271702
  13. The inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4) protein was significantly present more in interstial cystitis than controls PMID: 18455532
  14. ITIH4 is an anti-inflammatory protein, and suggests that further investigation into its potential use in the diagnosis and prognosis of acute ischemic stroke is warranted. PMID: 19263524

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
ITIH family
Tissue Specificity
Liver specific.
Database Links

HGNC: 6169

OMIM: 600564

KEGG: hsa:3700

STRING: 9606.ENSP00000266041

UniGene: Hs.709406

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*