Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

IFI35

Uniprot No.

P80217

Research Area

Cell Biology

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-286aa

Target Protein Sequence

SAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

37.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Acts as a signaling pathway regulator involved in innate immune system response. In response to interferon IFN-alpha, associates in a complex with signaling pathway regulator NMI to regulate immune response; the complex formation prevents proteasome-mediated degradation of IFI35 and correlates with IFI35 dephosphorylation. In complex with NMI, inhibits virus-triggered type I interferon/IFN-beta production. In complex with NMI, negatively regulates nuclear factor NF-kappa-B signaling by inhibiting the nuclear translocation, activation and transcription of the NF-kappa-B subunit p65/RELA, resulting in the inhibition of endothelial cell proliferation, migration and re-endothelialization of injured arteries. Beside its role as an intracellular signaling pathway regulator, also functions extracellularly as damage-associated molecular patterns (DAMPs) to promote inflammation when actively released by macrophage to the extracellular space during cell injury and pathogen invasion. Macrophage-secreted IFI35 activates NF-kappa-B signaling in adjacent macrophages through Toll-like receptor 4/TLR4 activation, thereby inducing NF-kappa-B translocation from the cytoplasm into the nucleus which promotes the release of proinflammatory cytokines.

Gene References into Functions

IFI35 enhances proliferation of mesangial cells and is regulated by MBD2 in lupus nephritis. PMID: 28064541
Damage-associated molecular patterns (DAMP) are important mediators of innate immunity. Here the authors show that N-myc and STAT interactor (NMI) and interferon-induced protein 35 (IFP35) act as DAMPs to promote inflammation by activating macrophages via the Toll-like receptor 4 and NF-kappaB pathways. PMID: 29038465
Study found that TLR3 signaling induces the expression of IFI35, and IFI35 negatively regulates IFN-beta-P-STAT1-RIG-I-CXCL10/CCL5 axis in U373MG cells. This suggests that IFI35 expressed in astrocytes may play an important role in regulating the innate immune system in astrocytoma cells. PMID: 28109979
Activation of TLR3 by poly IC induces the IFI35 expression in Mesangial Cells. Regional expression of IFI35 and its dysregulation may be involved in the pathogenesis of glomerular inflammation in CKD. PMID: 27639618
Trim21 regulates Nmi-IFI35 complex-mediated inhibition of innate antiviral response PMID: 26342464
Knockdown of IFP35 expression abolished pEGFP-N1-2C and pEGFP-N1-Nmi-induced activation of type I interferon promoters. PMID: 25085622
IFI35 negatively regulates RIG-I antiviral signaling and supports vesicular stomatitis virus replication. PMID: 24371060
IRF-1 also activates IFP35 expression in an IFN-gamma-inducible manner. PMID: 23226549
Dissociation of the IFN-induced protein IFP35 from NMI is a newly defined specific cytoplasmic event occurring during apoptosis. PMID: 11911807
The results provide a novel role of CKIP-1 in cytokine signaling response and the biochemical mechanism, by which two previously identified modulators IFP35 and Nmi are involved via interactions. PMID: 17197158
IFP35 can interact with the bovine Tas (BTas) regulatory protein of bovine foamy virus; overexpression of IFP35 disturbs the ability of BTas to activate viral-gene transcription and inhibits viral replication. PMID: 18305040

Hide All

Subcellular Location

Cytoplasm. Nucleus. Secreted.

Protein Families

NMI family

Tissue Specificity

Expressed in a wide range of cell types, including fibroblasts, macrophages, and epithelial cells.

Database Links

HGNC: 5399

OMIM: 600735

KEGG: hsa:3430

STRING: 9606.ENSP00000395590

UniGene: Hs.632258

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP011013HU
MSDS	MSDS
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Interferon-induced 35 kDa protein (IFI35)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage