Recombinant Human Interleukin-1 family member 10(IL1F10)

Code CSB-EP837869HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q8WWZ1
Relevance Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Family of interleukin 1-theta ;FIL1 thetaInterleukin-1 HY2 ;IL-1HY2Interleukin-1 theta ;IL-1 thetaInterleukin-38 ;IL-38
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW
Research Area Immunology
Source E.coli
Gene Names IL1F10
Expression Region 1-152aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 32.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2.
Subcellular Location Secreted
Protein Families IL-1 family
Tissue Specificity Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil.
Database Links

HGNC: 15552

OMIM: 615296

KEGG: hsa:84639

STRING: 9606.ENSP00000341794

UniGene: Hs.306974

Related Products

IL1F10 Antibodies

IL1F10 Antibodies for Homo sapiens (Human)

IL1F10 Antibodies for Human

IL1F10 Proteins

IL1F10 Proteins for Homo sapiens (Human)

IL1F10 ELISA Kit

IL1F10 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.