Recombinant Human Interleukin-1 receptor-like 1 (IL1RL1), partial

Code CSB-YP720306HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP720306HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP720306HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP720306HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP720306HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Interleukin-1 receptor-like 1; EC 3.2.2.6; Protein ST2; IL1RL1 DER4 ST2 T1
Species
Homo sapiens (Human)
Expression Region
19-328
Target Protein Sequence
KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHS
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for interleukin-33 (IL-33); signaling requires association of the coreceptor IL1RAP. Its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Possibly involved in helper T-cell function.; Inhibits IL-33 signaling.
Gene References into Functions
  1. Patients with heart failure and type 2 diabetes mellitus with AGT TT + MT genotype had a higher level of ST2 and a higher probability of unfavorable cardiovascular events during 24 months of observation compared with MM genotype carriers. PMID: 29578435
  2. IL33R was found induced in the blood of asthmatic children with additional gram-positive bacteria in the nasopharynx. PMID: 28262704
  3. Higher IL-33 and lower s-ST2 receptor baseline serum levels were detected in Pru p 3--sensitized allergic patients (SAP). IL-33/s-ST2 ratio is increased in Pru p 3-SAP and more in patients who experienced severe systemic symptoms. PMID: 29774370
  4. sST2 is downregulated in high-metastatic cells compared with low-metastatic human and mouse CRC cells. Knockdown of sST2 in low-metastatic cells enhances tumour growth, metastasis and tumour angiogenesis, whereas its overexpression in high-metastatic cells suppresses these processes. PMID: 27882929
  5. IL-33 promotes Renal Cell Carcinoma cell proliferation and chemotherapy resistance via its receptor ST2 and the JNK signaling activation in tumor cells. PMID: 29763892
  6. sST2 in preschool wheezers has predictive value for the development of eosinophilic airway inflammation in asthmatic children at school age. PMID: 28440062
  7. Findings indicate that IL33 may be involved in the process of glioma cell invasion and migration by upregulating MMP2 and MMP9 via the ST2-NF-kappaB signaling pathway. PMID: 28849217
  8. is involved in Th2 inflammation including eosinophil activation. Single nucleotide polymorphisms (SNPs) of the IL1RL1 gene are associated with asthma development and increased peripheral blood eosinophil counts. PMID: 29153414
  9. Findings indicate that IL-10 act as a negative regulator of IL-33/ST2 signaling pathways in vivo. PMID: 28415811
  10. Foxp3(+) cells in the brains of Multiple sclerosis patients predominantly produce interleukin-10 (IL-10) and show high expression of the IL-33 receptor ST2. PMID: 28169287
  11. In patients with stable mild to moderate chronic heart failure with reduced ventricular ejection fraction, a single measurement of sST2 protein and glucose were independent variables for hospitalization due to worsening CHF over a 1-year follow-up period. PMID: 29068593
  12. present study highlights significant associations between ST2 and inflammatory bowel disease. PMID: 27001944
  13. Data show that interleukin-2 receptor alpha, tumor necrosis factor receptor 1, serum STimulation-2 (IL1RL1 gene product), and regenerating islet-derived 3-alpha were significantly associated with non-relapse mortality. PMID: 28126963
  14. Serum IL-33 and sST2 levels, and CD4+ST2L+ expression in peripheral blood mononuclear cells are closely associated with HIV-1 infection and immune reconstitution in patients received highly-active antiretroviral therapy. PMID: 28466817
  15. Elevated levels of sST2 concentration in stable coronary heart disease patients may independently predict short- and long-term risk for fatal CVD events and total mortality but not non-fatal CVD events. PMID: 28283847
  16. Patients with severe aortic valve stenosis present elevated sST2 levels. Left ventricular global longitudinal strain resulted the only independent predictor of sST2 levels. PMID: 28664478
  17. The Il1RL1 rs950880 AA homozygote is an independent predictor of all-cause mortality in coronary artery disease and peripheral arterial disease patients. PMID: 28110258
  18. In a cohort of hypertensive heart failure subjects, soluble ST2 correlates significantly with indicators of right ventricular function. PMID: 28860791
  19. Data provide evidence that increased IL-33/ST2 levels in patients with chronic kidney disease are an indicator of increased inflammation, impaired endothelial functions, and cardiovascular events. PMID: 28614418
  20. Serum levels of IL33R were positively correlated with cognitive performance in patients with schizophrenia. PMID: 28126482
  21. Interleukin 1 receptor-like 1 (ST2/IL1RL1) is a biomarker for cardiac stress and heart failure, which can be associated with cocaine use. Data suggest that serum ST2/IL1RL1 levels are up-regulated by cocaine use; cocaine use appears to be associated with subclinical cardiac stress and damage outside of acute cardiac events; elevated serum ST2/IL1RL1 levels may serve as biomarkers for cocaine-induced cardiac complications. PMID: 28442257
  22. Preterm labor was associated with diminished expression of the alpha-chain of IL-33 receptor on choriodecidual B cells. PMID: 27918564
  23. Study found that macrophages expressed ST2L with a membrane pattern. The membrane pattern of ST2L was strongly expressed if the macrophages infiltrating the shoulder region of the plaque had an epithelioid aspect suggesting its possible role in the pathogenetic mechanisms of atherosclerotic lesions progression and rupture. PMID: 27223112
  24. The higher levels of IL-33 and its receptor ST2 in tissue and serum reflect an active inflammatory state and may represent a potential biomarker for disease activity. PMID: 26343805
  25. The genetic risk score for rs1041973 and rs16924161 demonstrated a higher risk for SPT positivity against B. tropicalis, the greater the number of risk alleles for both SNPs. Our findings demonstrate a robust association of genetic variants in IL1RL1 and IL33 SNPs with allergy markers and asthma. PMID: 28266165
  26. Increased sST2 and IL-10 but not IL-33 may be involved in the pathogenic process of IgAN. PMID: 27900334
  27. No significant differences in genotypic and allelic frequencies of thers13015714 in interleukin 1 receptor like 1 was observed between cases and controls and between mild/severe and early/late-onset Preeclampsia. PMID: 27023364
  28. IL-33 and ST2 are expressed in periapical granulomas and radicular cysts. PMID: 25677987
  29. An hyperexpression of soluble ST2 was found in Sjogren syndrome patients. PMID: 27097949
  30. ST2 is associated with advanced and metastatic disease in GC patients and significantly correlates with the duration of the disease. PMID: 26835712
  31. In patients with endometriosis, ST2 was positively associated with VAS score. PMID: 25069762
  32. rs1558641 was positively associated with atopic asthma in a Chinese population. PMID: 26493291
  33. two new polymorphisms in the distal promoter region of the ST2 gene that possibly influence susceptibility to severe coronary artery disease PMID: 20602249
  34. IL-33 and ST2 can be detected in lysates from both normal and pre-eclampsia placentas PMID: 21949719
  35. in an unselected cohort of patients admitted to the ICU, sST2 was an independent predictor of 90-day all-cause mortality PMID: 22155704
  36. The pro-T helper (Th)2 cell effects of mature IL-33 are due to differential utilization of the interleukin (IL)-33 receptor chain ST2, whereas their similar effects result from regulation of gene expression. PMID: 22634619
  37. Expression of IL-33 receptor ST2 in human adipose tissue is increased by severe obesity indicating an autocrine action. Thus, the adipose tissue microvasculature could participate in obesity-associated inflammation and related complications via IL-33/ST2. PMID: 22828942
  38. Elevated serum ST2 (and IL-33) were both associated with increased mortality in myocardial infarction patients. PMID: 22835988
  39. Serum soluble ST2 levels are increased in patients with pulmonary arterial hypertension. PMID: 23290950
  40. Soluble ST2 measurement provides diagnosis of stable heart failure in hypertensive patients. PMID: 23482076
  41. human cardiac and vascular cells have different distribution patterns of ST2 isoforms (sST2 and transmembrane ST2L) mRNA expression and produce different amounts of sST2 protein. PMID: 23567618
  42. A significant correlation was found between TNF-alpha and IL-33 mRNA expression in the asthmatic subjects. PMID: 23855553
  43. IL-33/sST2 may be involved in the pathogenesis of primary Sjogren's Syndrome (pSS) and partly contribute to the interstitial lung disease (ILD) in pSS patients. PMID: 23910012
  44. ST2 levels measured at the initiation of therapy for GVHD and during the first month after transplantation improved risk stratification for treatment-resistant GVHD and death without relapse after transplantation. PMID: 23924003
  45. Genetic variation in IL1RL1 can result in increased levels of ST2 and alter immune and inflammatory signaling through the ST2/IL-33 pathway. PMID: 23999434
  46. ST2 blood levels are higher in nonsurvivors than in surviving heart failure patients. PMID: 24239955
  47. Soluble ST2 serum levels improve long-term prediction in patients with renal insufficiency even more than in the total cohort. PMID: 24263122
  48. uPAR, IL-33, and ST2 values as a predictor of subclinical chorioamnionitis in preterm premature rupture of membranes. PMID: 24304137
  49. Serum ST2 levels were increased, and salivary gland expression was downregulated in patients with primary Sjogren's syndrome. PMID: 24385203
  50. increased sST2 was an independent predictor of long-term all-cause mortality PMID: 24401186

Show More

Hide All

Subcellular Location
[Isoform C]: Cell membrane.; [Isoform B]: Secreted.; Cell membrane; Single-pass type I membrane protein.
Protein Families
Interleukin-1 receptor family
Tissue Specificity
Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and the liver. Isoform C
Database Links

HGNC: 5998

OMIM: 601203

KEGG: hsa:9173

STRING: 9606.ENSP00000233954

UniGene: Hs.66

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1