Recombinant Human Interleukin-11 (IL11)

In Stock
Code CSB-EP011583HUa0
Abbreviation Recombinant Human IL11 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Adipogenesis inhibitory factor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-199aa
Target Protein Sequence
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and IL11RA activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. The interaction with the membrane-bound IL11RA and IL6ST stimulates 'classic signaling', whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates 'trans-signaling'.
Gene References into Functions
  1. the identification of a dysregulated miR-124/IL-11 axis helps elucidate mechanisms of breast cancer metastases to bone, uncovers new prognostic markers, and facilitates the development of novel therapeutic targets to treat and even prevent bone metastases of breast cancer. PMID: 29343249
  2. The results indicate that miR-23b regulates IL-11 and IL-11Ralpha expression, and it might act as an anti-oncogenic agent in the progression of Hepatocellular Carcinoma by directly downregulating IL-11 expression. PMID: 29901200
  3. It has been concluded that the renal cell carcinoma risk allele at 12p12.1 maps to rs7132434, a functional variant in an enhancer that upregulates BHLHE41 expression which, in turn, induces IL-11, a member of the IL-6 cytokine family. PMID: 27384883
  4. The results indicated that miR-124a has an important role as a tumor suppressor gene by targeting IL-11. PMID: 29286137
  5. Studied the role of ZEB1-AS1, and it's association with IL-11, in promoting STAT3 activation in B-lymphoblastic leukemia. PMID: 28861713
  6. Cancer-associated fibroblasts treated with cisplatin facilitate chemoresistance of lung adenocarcinoma through IL-11/IL-11R/STAT3 signaling pathway. PMID: 27922075
  7. results reveal a central role of IL-11 in fibrosis and we propose that inhibition of IL-11 is a potential therapeutic strategy to treat fibrotic diseases PMID: 29160304
  8. up-regulates GRP78 in the placenta PMID: 28487027
  9. The identification of the miR-206/TWF1/MKL1-SRF/IL11 signaling pathway sheds lights on the understanding of breast cancer initiation and progression, unveils new therapeutic targets, and facilitates innovative drug development to control cancer and block metastasis PMID: 27435395
  10. This review will discuss the available structural, functional, and bioinformatics knowledge concerning IL-11 and will summarize its relationship with several diseases PMID: 27312790
  11. Authors found a significant correlation between NRF2 and IL-11 status in breast cancer patients. Based on a recent report demonstrating that IL-11 is induced downstream of NRF2, authors examined the significance of IL-11 in NRF2-driven tumorigenesis with a newly established NRF2 addiction cancer model. PMID: 28714957
  12. this study shows that recombinant IL-11 is effective with tolerable adverse effects in Chinese patients with autoimmune thrombocytopenic purpura PMID: 27235596
  13. HMGA2 promoted colorectal cancer metastasis and epithelial-mesenchymal transition via activation of the FN1 and IL11/STAT3 signaling pathways. PMID: 26964871
  14. Together, these results suggest that the IL-11/STAT3 signaling pathway plays a critical role in human chronic atrophic gastritis , and may provide new targets to prevent and treat gastric cancer PMID: 27173233
  15. Proteolysis of the IL-11R represents a molecular switch that controls the IL-11 trans-signaling pathway which is the target in intestinal tumorigenesis, lung carcinomas, and asthma. PMID: 26876177
  16. IL-11 has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses, hence reducing the mortality in sepsis patients accompanied with thrombocytopenia. PMID: 26276375
  17. Results indicate that iterleukin-11 (IL11) is causal of Preeclampsia (PE) features in a mouse model and likely in women, and suggest potential of IL11 inhibition to rescue PE symptoms in women. PMID: 26655736
  18. The cross-talk between Th17 and interleukin 11 (IL-11+)CD4+ T cells may induce and amplify the autoimmune response in the early stage of multiple sclerosis (MS), and thus represent an attractive therapeutic target in this and other inflammatory diseases. PMID: 26452137
  19. Genetic variations of IL-11 may be associated with the risk of Hirschsprung disease and/or the mechanisms related to enteric nervous system development. PMID: 26172388
  20. IL-11 expression in breast cancer correlates with poor disease outcome PMID: 26209885
  21. data offer insight into the binding interactions of IL-11 with each of its receptors and the structural mechanisms underlying agonist and antagonist variants of the protein PMID: 25195742
  22. The highly specific IL-11 - S100P interaction occurring under physiologically relevant conditions should be taken into consideration upon development of the antineoplastics inhibiting IL-11 signaling. PMID: 26551460
  23. MTA2 overexpression enhances colony formation and tumor growth of gastric cancer cells, but not plays important role in cancer cell migration and metastasis. IL-11 is one of the downstream effectors of MTA2 in regulating gastric cancer cells growth PMID: 25929737
  24. IL-11 stimulates BSP gene transcription. PMID: 24633490
  25. The results prove the presence of the potentially functionally relevant IL-11 gene variants in the population of infertile women. PMID: 24635366
  26. High expression of interleukin-11 correlated with poor prognosis in clear-cell renal cell carcinoma patients. PMID: 25702890
  27. IL-11 is identified as a new Th17-promoting cytokine, because it induces a differentiation of naive CD4(+) T cells into Th17 cells, as well as expansion of Th17 memory cells. PMID: 25895532
  28. Low serum interleukin-11 are associated with pancreatic cancer. PMID: 25123265
  29. Pretreatment with rhIL-11 can reduce galactosamine-induced acute liver failure and protect the liver. PMID: 24817287
  30. In the presence of 100 ng/ml IL-11, GATA-3 transcript abundance rose up to ~85-fold of that measured in untreated cells, whereas T-bet transcripts were lowered merely to ~41% PMID: 24338248
  31. It Interleukin-11 (IL-11) is a pleiotropic cytokine that belongs to gp130 family. It plays a significant role in the synthesis and maturation of hematopoietic cells, inhibition of adipogenesis, regulation of embryo implantation, and trophoblasts invasion. PMID: 23631681
  32. DNA methylation of the CpG island in the IL-11 gene is associated with response of major depressive disorder patients to antidepressant drugs. PMID: 24002086
  33. IL-11 is associated with bone metastasis. PMID: 23813018
  34. IL11 given orally protects the intestinal mucosa from radiation damage PMID: 24219324
  35. IL-11 therefore drives a pathway that enhances HSPC radioresistance and radiation-induced B-cell malignancies, but is normally attenuated by the inhibitory adaptor Lnk. PMID: 24297922
  36. Solar simulted radiation-induced Il-11 may be involved in the photoaging-induced loss of facial subcutaneous fat. PMID: 23639700
  37. results suggest a two-step mechanism, whereby LfcinB induces TIMP-1 through an IL-11-dependent pathway involving transcription factor AP-1 and STAT3. PMID: 24036113
  38. induction of renal proximal tubule IL-11 is a critical intermediary in A1 adenosine receptor-mediated renal protection against acute ischemic kidney injury. PMID: 23813214
  39. the decreased ratio of IL-11/IL-17 might reflect an imbalance between the proinflammatory and anti-inflammatory cytokines in different periodontal diseases. PMID: 23226926
  40. An interleukin-6 family member, interleukin-11 is identified as a secondary target of twinfilin 1 in the microRNA-30c signalling pathway. PMID: 23340433
  41. Breast cancer cells may promote osteolysis in part by increasing the pool of osteoclast progenitor cells via tumor cell-derived IL-11. PMID: 23311882
  42. Enhanced production of IL-11 is associated with hepatocellular carcinoma metastasis to bone. PMID: 23307318
  43. IL11 is a hypoxia-inducible, VHL-regulated gene in human cancer cells and expression of IL11 mRNA is dependent, at least in part, on HIF-1. PMID: 23549086
  44. both the PI3K and Raf pathways are necessary for the expression of IL-11 in oncogenic Ras-mutated cells PMID: 23027619
  45. Data support the view that IL-11 is a key regulator of gastric damage acting to initiate chronic atrophic gastritis. PMID: 22180059
  46. IL-11 administration exhibits postconditioning effects through cardiac STAT3 activation, preventing myocardial ischemia-reperfusion injury. PMID: 22707562
  47. IL11 may be involved in endometrial cancer development PMID: 22614117
  48. Constructed a designer cytokine Hyper IL-11 (H11), which is exclusively composed of naturally existing components. It contains the full length sIL-11Ralpha connected with the mature IL-11 protein, and acts as an agonist on cells expressing the gp130 molec PMID: 22433466
  49. High Interleukin-11 is associated with multiple myeloma. PMID: 22289923
  50. Bovine lactoferrin administration prevented the progression of hepatic failure in human myofibroblasts and mice, and enhanced IL-11 and BMP2 expression in the small intestine. PMID: 21688123

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-6 superfamily
Database Links

HGNC: 5966

OMIM: 147681

KEGG: hsa:3589

STRING: 9606.ENSP00000264563

UniGene: Hs.467304

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*