Recombinant Human Interleukin-11(IL11),partial

In Stock
Code CSB-AP004581HU
Product Type Interleukin
Size US$195
Uniprot No. P20809
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 2% Glycine, pH 7.2
Alias Interleukin-11; IL-11; Adipogenesis Inhibitory Factor; AGIF; Oprelvekin; IL11
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using murine 7TD1 cells is typically 0.2 ng/mL
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Research Area Immunology
Source Yeast
Gene Names IL11
Expression Region 23-199aa
Tag Info Tag-Free
Mol. Weight 19 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production
Subcellular Location Secreted
Protein Families IL-6 superfamily
Database Links

HGNC: 5966

OMIM: 147681

KEGG: hsa:3589

STRING: 9606.ENSP00000264563

UniGene: Hs.467304

Pathway Jak-STAT signaling pathway
Hematopoietic cell lineage

Related Products

IL11 Antibodies

IL11 Antibodies for Homo sapiens (Human)

IL11 Proteins

IL11 Proteins for Homo sapiens (Human)

IL11 ELISA Kit

IL11 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.