Recombinant Human Interleukin-22 receptor subunit alpha-1 (IL22RA1), partial

Code CSB-EP822717HU
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
IL22RA1
Uniprot No.
Research Area
Immunology
Alternative Names
CRF2 9; CRF2-9; Cytokine receptor class-II member 9; cytokine receptor classII member 9; Cytokine receptor family 2 member 9; I22R1_HUMAN; IL-22 receptor subunit alpha-1; IL-22R-alpha-1; IL-22RA1; IL22 Receptor Alpha; IL22R; IL22R1; Il22ra1; ILTIF R1 chain; Interleukin 22 Receptor alpha 1; Interleukin 22 Receptor; Interleukin-22 receptor subunit alpha-1; ZcytoR11
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
250-573aa
Target Protein Sequence
SYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
50.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the receptor for IL20, IL22 and IL24. Component of IL22 receptor formed by IL22RA1 and IL10RB enabling IL22 signaling via JAK/STAT pathways. IL22 also induces activation of MAPK1/MAPK3 and Akt kinases pathways. Component of one of the receptor for IL20 and IL24 formed by IL22RA1 and IL20RB also signaling through STATs activation. Mediates IL24 antiangiogenic activity as well as IL24 inhibitory effect on endothelial cell tube formation and differentiation.
Gene References into Functions
  1. increased expression of IL-22Ralpha therefore promotes keratinocyte proliferation and pro-inflammatory cytokine production during UVB-induced skin inflammation, suggesting that UVB facilitates skin inflammation by increasing the responsiveness of keratinocytes to IL-22 PMID: 28558005
  2. IL-22 and its receptor have a crucial role in the development and pathogenesis of uveitis by facilitating inflammatory cell infiltration. PMID: 27166675
  3. high expression profile of IL-22R1 in nonsmall cell lung cancer is an independent indicator of poor overall survival PMID: 26846835
  4. phosphorylation of STAT3 and AKT was highly induced by treatment with IL-22 via IL-22R1. IL-22R1 was also consistently overexpressed in recurrent NSCLC tissues PMID: 26983629
  5. These data suggest that imbalance of IL-22/IL-22R1 signaling regulates the pathogenesis of chronic rhinosinusitis with nasal polyps, including local eosinophilia, via alteration of MUC1 expression. PMID: 27502468
  6. FBXW12 functions as an E3 ligase constituent to ubiquitinate and degrade IL-22R and that therapeutic FBXW12 inhibition may enhance IL-22 signaling and bolster mucosal host defense and infection containment. PMID: 26171402
  7. IL-22R1 is over-expressed in primary Sjogren's syndrome and Sjogren-associated non-Hodgkin lymphomas and is regulated by IL-18. PMID: 25880879
  8. IL-22 has restricted tissue specificity as its unique receptor IL-22R1 is exclusively expressed on epithelial and tissue cells, but not immune cells. PMID: 24856143
  9. serum IL-22 levels are significantly higher in patients with pituitary macroadenomas than in healthy controls and IL-22R is variably expressed in both prolactinoma and non-functioing pituitary adenoma cells. PMID: 23512698
  10. High expression of interleukin-22 receptor is associated with pancreatic ductal adenocarcinoma. PMID: 24132627
  11. the CC genotype of rs3795299 polymorphism in the IL-22R1 gene is associated with the reduced risk of IgAN, and this genetic association was supported by the higher renal expression of IL-22R1 in healthy controls compared with patients with IgAN. PMID: 23659670
  12. Letter: calcipotriol inhibits the IL-22-induced epidermal hyperplasia by decreasing keratinocyte proliferation and down-modulating IL-22R expression. PMID: 23688404
  13. Data show that IL-17RA, IL-17RC, IL-22R1, ERK1/2 MAPK and NF-kappaB pathways are involved in Th17 cytokine-induced proliferation. PMID: 22898922
  14. IL-22R1 mRNA and protein expressions in HASMCs were significantly increased after stimulation by serum from asthmatic patients, but decreased after co-stimulation with dexamethasone. PMID: 21690049
  15. This study documents a previously unknown role of IL-22R1 in inflammation and identifies the involvement of IL-22R1/IL-22 in anaplastic lymphoma kinase-positive anaplastic large cell lymphoma PMID: 20971950
  16. Tyr251 and Tyr301 of IL-22R1 are required for Shp2 binding and IL-22-induced Erk1/2 activation. PMID: 20671117
  17. study demonstrated IL-22R1 mRNA and protein expression on nasal epithelial cells; failure of medical and surgical therapy in chronic rhinosinusitis with nasal polyps is associated with significantly decreased expression of IL-22R1 PMID: 17906500
  18. The islets of Langerhans are the local site for IL-22R1 expression in the human pancreas. PMID: 18376313
  19. Molecular basis for the distinct affinities and specificities of IL-22 and IL-10 receptor chains that regulate cellular targeting and signal transduction to elicit effective immune responses. PMID: 18599299
  20. A 1.9A crystal structure of the IL-22/IL-22R1 complex is reported. PMID: 18675809
  21. identifies those amino acid side chains of IL-22 that are individually important for optimal binding to IL-22R PMID: 18675824
  22. Comparison of IL-22/IL-22BP and IL-22/IL-22R1 crystal structures shows that both receptors display an overlapping IL-22 binding surface, which is consistent with the inhibitory role played by IL-22 binding protein. PMID: 19285080
  23. Data show that deletion of the C-terminal part of IL-22R dramatically decreased its ability to activate STAT3. PMID: 19632985
  24. Increased IL-22R expression in epidermal keratinocytes contributes to the pathogenesis of psoriasis through enhancing the coordinated effects of IL-22 and IL-17, inducing the production of the IL-20 subfamily, chemokines, and growth factors. PMID: 19731362

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Type II cytokine receptor family
Tissue Specificity
Expressed in colon, liver, lung, pancreas and kidney. No expression in immune cells such as monocytes, T-cells, and NK-cells. Expressed in keratinocytes of normal skin as well as in psoriatic skin lesion. Detected in normal blood brain barrier endothelial
Database Links

HGNC: 13700

OMIM: 605457

KEGG: hsa:58985

STRING: 9606.ENSP00000270800

UniGene: Hs.110915

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*